MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint ishmukhamet-2010-1 Direct observation of stepped proteolipid ring rotation in E. coli F₀F₁-ATP synthase. in vitro In vitro biophysical biophysical predetermined predetermined participant predetermined Ishmukhametov R., Hornung T., Spetzler D., Frasch WD. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation atpl_ecoli ATP synthase subunit c Lipid-binding protein Dicyclohexylcarbodiimide-binding protein atpE papH uncE b3737 JW3715 ATP synthase F(0) sector subunit c F-type ATPase subunit c protein protein ecoli Escherichia coli (strain K12) MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLVDAIPMIAVGLGLYVMFAVA atp6_ecoli ATP synthase subunit a atpB papD uncB b3738 JW3716 F-ATPase subunit 6 ATP synthase F0 sector subunit a protein protein ecoli Escherichia coli (strain K12) MASENMTPQDYIGHHLNNLQLDLRTFSLVDPQNPPATFWTINIDSMFFSVVLGLLFLVLFRSVAKKATSGVPGKFQTAIELVIGFVNGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDLLPIDLLPYIAEHVLGLPALRVVPSADVNVTLSMALGVFILILFYSIKMKGIGGFTKELTLQPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVPWAIFHILIITLQAFIFMVLTIVYLSMASEEH atpb-atpe-2 1014102 atpl_ecoli ATP synthase subunit c 1014103 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified atp6_ecoli ATP synthase subunit a 1014104 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f4 f5 mint