UniProt UniProt http://www.uniprot.org cui-2010a-4 BLOS1, a putative BLOC-1 subunit, interacts with SNX1 and modulates root growth in Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Cui Y., Li X., Chen Q., He X., Yang Q., Zhang A., Yu X., Chen H., Liu N., Xie Q., Yang W., Zuo J., Palme K., Li W. wli@genetics.ac.cn J. Cell. Sci. (0021-9533) 2010 Only protein-protein interactions imex curation cui-2010a-5 BLOS1, a putative BLOC-1 subunit, interacts with SNX1 and modulates root growth in Arabidopsis. arath-protoplast Arabidopsis thaliana protoplast Protoplast defined as a membrane-bound cell from which the outer wall has been partially or completely removed. bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Cui Y., Li X., Chen Q., He X., Yang Q., Zhang A., Yu X., Chen H., Liu N., Xie Q., Yang W., Zuo J., Palme K., Li W. wli@genetics.ac.cn J. Cell. Sci. (0021-9533) 2010 Only protein-protein interactions imex curation cui-2010a-1 BLOS1, a putative BLOC-1 subunit, interacts with SNX1 and modulates root growth in Arabidopsis. arath-protoplast Arabidopsis thaliana protoplast Protoplast defined as a membrane-bound cell from which the outer wall has been partially or completely removed. fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Cui Y., Li X., Chen Q., He X., Yang Q., Zhang A., Yu X., Chen H., Liu N., Xie Q., Yang W., Zuo J., Palme K., Li W. wli@genetics.ac.cn J. Cell. Sci. (0021-9533) 2010 Only protein-protein interactions imex curation cui-2010a-2 BLOS1, a putative BLOC-1 subunit, interacts with SNX1 and modulates root growth in Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Cui Y., Li X., Chen Q., He X., Yang Q., Zhang A., Yu X., Chen H., Liu N., Xie Q., Yang W., Zuo J., Palme K., Li W. wli@genetics.ac.cn Arabidopsis cDNA J. Cell. Sci. (0021-9533) 2010 Only protein-protein interactions imex curation cui-2010a-3 BLOS1, a putative BLOC-1 subunit, interacts with SNX1 and modulates root growth in Arabidopsis. allce Allium cepa (Onion) Onion bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Cui Y., Li X., Chen Q., He X., Yang Q., Zhang A., Yu X., Chen H., Liu N., Xie Q., Yang W., Zuo J., Palme K., Li W. wli@genetics.ac.cn J. Cell. Sci. (0021-9533) 2010 Only protein-protein interactions imex curation bl1s1_arath Biogenesis of lysosome-related organelles complex 1 subunit 1 BLOS1 GCN5-like protein 1 GCN5L1 Protein RT14 homolog T09D09.14 At2g30330 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNTPMSLSAARGRMLPFLEKEKSEEESETLESSLLQLIDDNRRSSLQLREKTERSRKEAIRHAARTADLLVKAVNGGVEECFVNEKRIESEIRNLAITVAKFGKQTDQWLAVTHAVNSAVKEIGDFENWMKTMEFDCKKITAAIRNIHEDQQ snx1_arath Sorting nexin 1 SNX1 VPS5 Vacuolar protein sorting-associated protein 5 homolog K16F4.11 MBL20 At5g06140 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MESTEQPRNISGSMQSPRSPSSHPYLSVSVTDPVKLGNGVQAYISYRVITKTNLPEYQGPEKIVIRRYSDFVWLRDRLFEKYKGIFIPPLPEKSAVEKFRFSAEFIEMRRAALDIFVNRIALHPELQQSEDLRTFLQADEETMDRFRFQETSIFKKPADLMQMFRDVQSKVSDAVLGKEKPVEETTADYEKLKHYIFELENHLTEAQKHAYRLVKRHRELGQSLLDFGKAVKLLGACEGEPTGKAFSDLGTKSELLSIKLQKEAQQVLMNFEEPLKDYVRYVQSIKATIAERGTAFKQHCELSETTKLKEINLDKLMLTRSDKVGEAEIEYREIKAESEEATRRFERIVKRMEDEIVRFQEQKTEEMGVAFHQFAKGQARLANSVADAWRSLLPKLEASYSV bl1s2_arath Biogenesis of lysosome-related organelles complex 1 subunit 2 BLOS2 K6M13.19 At5g49550 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADSRDDLAESLQNLFTSVSSMVKSELQGTNNHLDLLEKMNLRVASEYDDMGDVAAGLRVFAEQMKSKSGGLDEFVGQMDAIEKQVSEFEAVISVLDRYVSVLESKIRAEYRHPHHQRRSNDSVVTD bl1s1-snx1-7 1185359 n/a 1185364 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1185365 unspecified role unspecified role prey prey physical association physical association false false false Fig. 5A, 5B bl1s1-q570l7 1185359 n/a 1185366 unspecified role unspecified role prey prey n/a 1185364 unspecified role unspecified role bait bait physical association physical association false false false Fig.1A snx1-q570l7-1 1185359 n/a 1185365 unspecified role unspecified role bait bait n/a 1185366 unspecified role unspecified role prey prey physical association physical association false false false Fig. 5C bl1s1-q570l7-10 1185360 n/a 1185364 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1185366 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1B bl1s1-snx1-6 1185360 n/a 1185365 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1185364 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5F bl1s1-snx1-5 1185361 n/a 1185365 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1185364 unspecified role unspecified role neutral component neutral component region fluorescent prot tag fluorescent protein tag fluorescent prot tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 5D bl1s1-snx1-1 1185362 n/a 1185365 unspecified role unspecified role prey prey n/a 1185364 unspecified role unspecified role bait bait physical association physical association false false false Fig. 5A, 5B bl1s1-snx1-3 1185363 n/a 1185364 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1185365 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5E