MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint fraldi-2010-2 Lysosomal fusion and SNARE function are impaired by cholesterol accumulation in lysosomal storage disorders. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Fraldi A., Annunziata F., Lombardi A., Kaiser HJ., Medina DL., Spampanato C., Fedele AO., Polishchuk R., Sorrentino NC., Simons K., Ballabio A. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation fraldi-2010-1 Lysosomal fusion and SNARE function are impaired by cholesterol accumulation in lysosomal storage disorders. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Fraldi A., Annunziata F., Lombardi A., Kaiser HJ., Medina DL., Spampanato C., Fedele AO., Polishchuk R., Sorrentino NC., Simons K., Ballabio A. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation fraldi-2010-3 Lysosomal fusion and SNARE function are impaired by cholesterol accumulation in lysosomal storage disorders. in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation predetermined predetermined participant predetermined Fraldi A., Annunziata F., Lombardi A., Kaiser HJ., Medina DL., Spampanato C., Fedele AO., Polishchuk R., Sorrentino NC., Simons K., Ballabio A. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation vamp7_mouse Vesicle-associated membrane protein 7 Vamp7 Sybl1 Synaptobrevin-like protein 1 protein protein mouse Mus musculus Mouse MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFSFLNEVKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENKSLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKNIKLTIIIIIVSIVFIYIIVSLLCGGFTWPNCVKK lamp1_mouse Lysosome-associated membrane glycoprotein 1 Lysosomal membrane glycoprotein A 120 kDa lysosomal membrane glycoprotein LGP-120 P2B CD107 antigen-like family member A Lamp1 Lamp-1 protein protein mouse Mus musculus Mouse MAAPGARRPLLLLLLAGLAHGASALFEVKNNGTTCIMASFSASFLTTYETANGSQIVNISLPASAEVLKNGSSCGKENVSDPSLTITFGRGYLLTLNFTKNTTRYSVQHMYFTYNLSDTEHFPNAISKEIYTMDSTTDIKADINKAYRCVSDIRVYMKNVTVVLRDATIQAYLSSGNFSKEETHCTQDGPSPTTGPPSPSPPLVPTNPTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEECVQDGNNMLIPIAVGGALAGLVLIVLIAYLIGRKRSHAGYQTI vti1b_mouse Vesicle transport through interaction with t-SNAREs homolog 1B Vesicle transport v-SNARE protein Vti1-like 1 Vti1-rp1 Vti1b Vti1l1 protein protein mouse Mus musculus Mouse MAASAASSEHFEKLHEIFRGLLEDLQGVPERLLGTAGTEEKKKLVRDFDENQQEANETLAEMEEELRYAPLTFRNPMMSKLRNYRKDLAKLHREVRSTPLTAAPGGRGDLKYGTYTLENEHLNRLQSQRALLLQGTESLNRATQSIERSHRIATETDQIGTEIIEELGEQRDQLERTKSRLVNTNENLSKSRKILRSMSRKVITNKLLLSVIILLELAILVGLVYYKFFRHH goga1_mouse Golgin subfamily A member 1 Golga1 Golgin-97 protein protein mouse Mus musculus Mouse MFAKLKKKIAEETAVAQRPGGTTRIPRSVSKESVASMGADSGDDFASDGSSSREDLSSQLLRRNEQIRKLEARLSDYAEQVRNLQKIKEKLEIALEKHQDSSMRKFQEQNETFQASRAKMAEGLALALARKDQEWSEKMEQLEKDKRFLTSQLQEVKNQSLSLFQKRDEIDELEGFQQQEISKVKHMLLKKEECLGKMEQELDARTRELNRTQEELVTSNQLSSDLNERLEELQRHCSTLEEQRDHLTASKAGAEHKIVVLEQKEQELQAIIQQHSIDLQKVTAETQEKEKVITHLQEKVIFLEKRLEQNLSGEDHVQELLKEKTVAEQNLEDTRQQLLAARNSHTKALYLLETRVKDLERSLQAAEEQLSQSRNVVADQEAQIQKLITTNQENSLSQQQVLALEQHCRERIHALEAQIEALEQTRVADQIASEQGMLQLQQENVALKESRNECEHSLQHHQLELKKLKDEWSQREIVSVAMAQALEEVRKQREEFQQQATELTAIIEEKNQSLCEKDEALLQKEQELRQLEKGHSSALLQMHKLQRELEALKTCKAQEAMPATTGEDCLPLQGQEPLVISKAMQNSEYELPAAEGTPNGEVGASDLKQLQKEKQDLEQQLIEKNKIMKQMQQRMLELKKTLQKELKIRPDSELFEVREKTGPEIPNMAPSVTNNTDLTDAREINFEYLKHVVLKFMSCRESEAFHLIKAVSVLLNFSQEEENMLKETLEYKMSWFGSKPTPKGSIRPSISNPRIPWS stx7_mouse Syntaxin-7 Stx7 Syn7 protein protein mouse Mus musculus Mouse MSYTPGIGGDSAQLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQLLQQKQQYTNQLAKETDKYIKEFGSLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKAQRQAAEREKEFVARVRASSRVSGGFPEDSSKEKNLVSWESQTQPQVQVQDEEITEDDLRLIHERESSIRQLEADIMDINEIFKDLGMMIHEQGDMIDSIEANVESAEVHVQQANQQLSRAADYQRKSRKTLCIIIFILVVRIVIICLIVWGLKG lamp1-vamp7 1013633 vamp7_mouse Vamp7 1013636 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell lamp1_mouse lamp1 1013637 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell vti1b_mouse Vti1b 1013638 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f7a homomint mint golga1-lamp1 1013633 goga1_mouse Golgin-97 1013639 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell vti1b_mouse Vti1b 1013638 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell lamp1_mouse LAMP1 1013637 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false homomint mint sf5 vti1b-stx7 1013634 vti1b_mouse Vti1b 1013638 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level stx7_mouse Syntaxin-7 1013640 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level vamp7_mouse Vamp7 1013636 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false f6b mint stx7-vamp7 1013635 stx7_mouse Syntaxin-7 1013640 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level vamp7_mouse Vamp7 1013636 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level vti1b_mouse Vti1b 1013638 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false f5a mint