IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ teixeira-2010-1 Identification of FBXO25-interacting proteins using an integrated proteomics approach. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down western blot western blot Immuno blot Immuno blot Teixeira FR., Yokoo S., Gartner CA., Manfiolli AO., Baqui MM., Assmann EM., Maragno AL., Yu H., de Lanerolle P., Kobarg J., Gygi SP., Gomes MD. GST/HA-FBXO25/WT-FLAG, GST/HA-FBXO25-delF-FLAG constructs used for purification by anti FLAG M2 affinity gel resin. mdamario@fmrp.usp.br Proteomics (1615-9853) 2010 Only protein-protein interactions imex curation teixeira-2010-2 Identification of FBXO25-interacting proteins using an integrated proteomics approach. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Teixeira FR., Yokoo S., Gartner CA., Manfiolli AO., Baqui MM., Assmann EM., Maragno AL., Yu H., de Lanerolle P., Kobarg J., Gygi SP., Gomes MD. GST/HA-FBXO25/WT-FLAG, GST/HA-FBXO25-delF-FLAG constructs used for purification by anti FLAG M2 affinity gel resin. mdamario@fmrp.usp.br Proteomics (1615-9853) 2010 Only protein-protein interactions imex curation teixeira-2010-3 Identification of FBXO25-interacting proteins using an integrated proteomics approach. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Teixeira FR., Yokoo S., Gartner CA., Manfiolli AO., Baqui MM., Assmann EM., Maragno AL., Yu H., de Lanerolle P., Kobarg J., Gygi SP., Gomes MD. GST/HA-FBXO25/WT-FLAG, GST/HA-FBXO25-delF-FLAG constructs used for purification by anti FLAG M2 affinity gel resin. mdamario@fmrp.usp.br Proteomics (1615-9853) 2010 Only protein-protein interactions imex curation teixeira-2010-4 Identification of FBXO25-interacting proteins using an integrated proteomics approach. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down fingerprinting peptide massfingerprinting fingerprinting Teixeira FR., Yokoo S., Gartner CA., Manfiolli AO., Baqui MM., Assmann EM., Maragno AL., Yu H., de Lanerolle P., Kobarg J., Gygi SP., Gomes MD. GST/HA-FBXO25/WT-FLAG, GST/HA-FBXO25-delF-FLAG constructs used for purification by anti FLAG M2 affinity gel resin. mdamario@fmrp.usp.br Proteomics (1615-9853) 2010 Only protein-protein interactions imex curation teixeira-2010-5 Identification of FBXO25-interacting proteins using an integrated proteomics approach. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Teixeira FR., Yokoo S., Gartner CA., Manfiolli AO., Baqui MM., Assmann EM., Maragno AL., Yu H., de Lanerolle P., Kobarg J., Gygi SP., Gomes MD. GST/HA-FBXO25/WT-FLAG, GST/HA-FBXO25-delF-FLAG constructs used for purification by anti FLAG M2 affinity gel resin. mdamario@fmrp.usp.br Proteomics (1615-9853) 2010 Only protein-protein interactions imex curation skp1_human S-phase kinase-associated protein 1 SKP1 EMC19 OCP2 SKP1A TCEB1L Cyclin-A/CDK2-associated protein p19 p19skp1 RNA polymerase II elongation factor-like protein Organ of Corti protein 2 Organ of Corti protein II SIII Transcription elongation factor B polypeptide 1-like protein protein human Homo sapiens Human MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK fbx25_human F-box only protein 25 FBXO25 FBX25 protein protein human Homo sapiens Human MPFLGQDWRSPGWSWIKTEDGWKRCESCSQKLERENNRCNISHSIILNSEDGEIFNNEEHEYASKKRKKDHFRNDTNTQSFYREKWIYVHKESTKERHGYCTLGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQLTSLSGVAQKNYFNILDKIVQKVLDDHHNPRLIKDLLQDLSSTLCILIRGVGKSVLVGNINIWICRLETILAWQQQLQDLQMTKQVNNGLTLSDLPLHMLNNILYRFSDGWDIITLGQVTPTLYMLSEDRQLWKKLCQYHFAEKQFCRHLILSEKGHIEWKLMYFALQKHYPAKEQYGDTLHFCRHCSILFWKDYHLALLFKDSGHPCTAADPDSCFTPVSPQHFIDLFKF cand1_human Cullin-associated NEDD8-dissociated protein 1 KIAA0829 TIP120 TIP120A Cullin-associated and neddylation-dissociated protein 1 p120 CAND1 TBP-interacting protein of 120 kDa A CAND1 protein protein human Homo sapiens Human MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKEQLRDISSIGLKTVIGELPPASSGSALAANVCKKITGRLTSAIAKQEDVSVQLEALDIMADMLSRQGGLLVNFHPSILTCLLPQLTSPRLAVRKRTIIALGHLVMSCGNIVFVDLIEHLLSELSKNDSMSTTRTYIQCIAAISRQAGHRIGEYLEKIIPLVVKFCNVDDDELREYCIQAFESFVRRCPKEVYPHVSTIINICLKYLTYDPNYNYDDEDEDENAMDADGGDDDDQGSDDEYSDDDDMSWKVRRAAAKCLDAVVSTRHEMLPEFYKTVSPALISRFKEREENVKADVFHAYLSLLKQTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPGALTQHIPVLVPGIIFSLNDKSSSSNLKIDALSCLYVILCNHSPQVFHPHVQALVPPVVACVGDPFYKITSEALLVTQQLVKVIRPLDQPSSFDATPYIKDLFTCTIKRLKAADIDQEVKERAISCMGQIICNLGDNLGSDLPNTLQIFLERLKNEITRLTTVKALTLIAGSPLKIDLRPVLGEGVPILASFLRKNQRALKLGTLSALDILIKNYSDSLTAAMIDAVLDELPPLISESDMHVSQMAISFLTTLAKVYPSSLSKISGSILNELIGLVRSPLLQGGALSAMLDFFQALVVTGTNNLGYMDLLRMLTGPVYSQSTALTHKQSYYSIAKCVAALTRACPKEGPAVVGQFIQDVKNSRSTDSIRLLALLSLGEVGHHIDLSGQLELKSVILEAFSSPSEEVKSAASYALGSISVGNLPEYLPFVLQEITSQPKRQYLLLHSLKEIISSASVVGLKPYVENIWALLLKHCECAEEGTRNVVAECLGKLTLIDPETLLPRLKGYLISGSSYARSSVVTAVKFTISDHPQPIDPLLKNCIGDFLKTLEDPDLNVRRVALVTFNSAAHNKPSLIRDLLDTVLPHLYNETKVRKELIREVEMGPFKHTVDDGLDIRKAAFECMYTLLDSCLDRLDIFEFLNHVEDGLKDHYDIKMLTFLMLVRLSTLCPSAVLQRLDRLVEPLRATCTTKVKANSVKQEFEKQDELKRSAMRAVAALLTIPEAEKSPLMSEFQSQISSNPELAAIFESIQKDSSSTNLESMDTS cul1_human Cullin-1 CUL1 protein protein human Homo sapiens Human MSSTRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDEVELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA actb_human Actin, cytoplasmic 1 ACTB Beta-actin protein protein human Homo sapiens Human MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF q8tcj0-2 F-box only protein 25 FBXO25 FBX25 protein protein human Homo sapiens Human MPFLGQDWRSPGWSWIKTEDGWKRCESCSQKLERENNRCNISHSIILNSEDGEIFNNEEHEYASKKRKKDHFRNDTNTQSFYREKWIYVHKESTKERHGYCTLGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQLTSLSGVAQKNYFNILDKIVQKVLDDHHNPRLIKDLLQDLSSTLCILIRGVGKSVLVGNINIWICRLETILAWQQQLQDLQMTKQVNNGLTLSDLPLHMLNNILYRFSDGWDIITLGQVTPTLYMLSEDRQLWKKLCQYHFAEKQFCRHLILSEKGHIEWKLMYFALQKHYPAKEQYGDTLHFCRHCSILFWKDSGHPCTAADPDSCFTPVSPQHFIDLFKF No experimental confirmation available q8tcj0-3 F-box only protein 25 FBXO25 FBX25 protein protein human Homo sapiens Human MEKYSIMKSMNMHRKKGKRTILEMTQILKRHGYCTLGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQLTSLSGVAQKNYFNILDKIVQKVLDDHHNPRLIKDLLQDLSSTLCILIRGVGKSVLVGNINIWICRLETILAWQQQLQDLQMTKQVNNGLTLSDLPLHMLNNILYRFSDGWDIITLGQVTPTLYMLSEDRQLWKKLCQYHFAEKQFCRHLILSEKGHIEWKLMYFALQKHYPAKEQYGDTLHFCRHCSILFWKDSGHPCTAADPDSCFTPVSPQHFIDLFKF No experimental confirmation available. fbxo25-cand1 1012681 n/a 1012686 unspecified role unspecified role prey prey n/a 1012687 unspecified role unspecified role bait bait n terminal gst/ha tandem tag tandem tag n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain false c terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false f domain required to bind necessary binding region required to bind range range range range false n/a 1012688 unspecified role unspecified role prey prey n/a 1012689 unspecified role unspecified role prey prey association association false false false 2 fbxo25-actin 1012681 n/a 1012687 unspecified role unspecified role bait bait undefined mutation mutation mutation range range range range false n terminal gst/ha tandem tag tandem tag n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain false c terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1012690 unspecified role unspecified role prey prey physical association physical association false false false fig 4 fbxo25-cand1-1 1012681 n/a 1012688 unspecified role unspecified role prey prey n/a 1012687 unspecified role unspecified role bait bait n terminal gst/ha tandem tag tandem tag n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain false c terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false undefined mutation mutation mutation range range range range false association association false false false 2 cul1-fbxo25 1012682 n/a 1012689 unspecified role unspecified role neutral component neutral component n/a 1012687 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false fig 3 actb-fbxo25 1012682 n/a 1012690 unspecified role unspecified role neutral component neutral component n/a 1012687 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false fig 7 fbxo25-actb 1012683 n/a 1012691 unspecified role unspecified role bait bait delta f-box region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false range range certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 1012690 unspecified role unspecified role prey prey physical association physical association false false false fig 5 fbxo25-actb-3 1012683 n/a 1012691 unspecified role unspecified role bait bait delta f-box region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false range range certain certain sequence position certain false n/a 1012690 unspecified role unspecified role prey prey n terminus required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false fig 6 fbxo25-actb-2 1012684 n/a 1012689 unspecified role unspecified role prey prey 633-645 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 230-242 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 727-741 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 75-90 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 275-289 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 299-315 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 118-127 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 579-587 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 247-262 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 339-354 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 377-397 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 507-515 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 365-375 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 436-454 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 118-127 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 14-25 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 26-34 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 455-464 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 106-117 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 474-491 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 74-90 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 1012686 unspecified role unspecified role prey prey 95-113 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 6-22 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 81-94 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 82-94 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 1012688 unspecified role unspecified role prey prey 1179-1191 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 535-548 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 535-548 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 730-743 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 668-679 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 991-1005 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 1014-1023 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 813-826 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 1012692 unspecified role unspecified role bait bait n terminal gst/ha tandem tag tandem tag n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain false c terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 68-79 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 80-87 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 123-135 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 43-53 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 263-290 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 1012690 unspecified role unspecified role prey prey 96-113 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 360-372 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 197-206 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 292-312 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 148-177 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 291-312 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false 292-312 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false association association false false false fbxo25-actb 1012685 n/a 1012690 unspecified role unspecified role prey prey n/a 1012691 unspecified role unspecified role bait bait delta f-box region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false certain certain sequence position certain range range false physical association physical association false false false fig 5 and 6