MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint kajino-2006-1 Protein phosphatase 6 down-regulates TAK1 kinase activation in the IL-1 signaling pathway. in vitro In vitro phosphatase assay phosphatase assay predetermined predetermined participant predetermined Kajino T., Ren H., Iemura S., Natsume T., Stefansson B., Brautigan DL., Matsumoto K., Ninomiya-Tsuji J. J. Biol. Chem. (0021-9258) 2006 rapid curation kajino-2006-3 Protein phosphatase 6 down-regulates TAK1 kinase activation in the IL-1 signaling pathway. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Kajino T., Ren H., Iemura S., Natsume T., Stefansson B., Brautigan DL., Matsumoto K., Ninomiya-Tsuji J. J. Biol. Chem. (0021-9258) 2006 rapid curation kajino-2006-2 Protein phosphatase 6 down-regulates TAK1 kinase activation in the IL-1 signaling pathway. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kajino T., Ren H., Iemura S., Natsume T., Stefansson B., Brautigan DL., Matsumoto K., Ninomiya-Tsuji J. J. Biol. Chem. (0021-9258) 2006 rapid curation pp2aa_human Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform PPP2CA Replication protein C protein protein human Homo sapiens Human MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL m3k7_human Mitogen-activated protein kinase kinase kinase 7 MAP3K7 TAK1 Transforming growth factor-beta-activated kinase 1 protein protein human Homo sapiens Human MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQSESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGNILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPTRSHPWTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQKRQGTS ppp6_human Serine/threonine-protein phosphatase 6 catalytic subunit PPP6C PPP6 protein protein human Homo sapiens Human MAPLDLDKYVEIARLCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTTTPYFL map3k7-ppp2ca 1181922 pp2aa_human 1181925 enzyme enzyme neutral component neutral component m3k7_human 1181926 enzyme target enzyme target substrate substrate neutral component neutral component dephosphorylation dephosphorylation reaction dephosphorylation false false false f3 homomint mint map3k7-ppp6c 1181922 ppp6_human 1181927 enzyme enzyme neutral component neutral component m3k7_human 1181926 enzyme target enzyme target substrate substrate neutral component neutral component dephosphorylation dephosphorylation reaction dephosphorylation false false false f5 homomint mint ppp6c-map3k7 1181923 ppp6_human 1181927 unspecified role unspecified role bait bait m3k7_human 1181926 unspecified role unspecified role prey prey physical association physical association false false false f4 homomint mint map3k7-ppp6c-2 1181923 ppp6_human 1181927 unspecified role unspecified role prey prey m3k7_human 1181926 unspecified role unspecified role bait bait physical association physical association false false false f4 homomint mint map3k7-ppp6c-1 1181924 m3k7_human 1181926 unspecified role unspecified role bait bait ppp6_human 1181927 unspecified role unspecified role prey prey physical association physical association false false false f4 homomint mint