IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ popovici-2006-2 Direct and heterologous approaches to identify the LET-756/FGF interactome. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Popovici C., Berda Y., Conchonaud F., Harbis A., Birnbaum D., Roubin R. For the sequence name C15C8.3, two UniProt proteins were found ( Q18020 and E0AHB8) . The longer protein has been entered as both proteins have an identical sequence for aas 240 - end. roubin@marseille.inserm.fr Two cDNA libraries were used, either derived from mixed stages worms, or from a normalized library, containing one representative of each expressed gene of the whole genome (ORFeome). BMC Genomics (null) 2006 Only protein-protein interactions imex curation popovici-2006-4 Direct and heterologous approaches to identify the LET-756/FGF interactome. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Popovici C., Berda Y., Conchonaud F., Harbis A., Birnbaum D., Roubin R. roubin@marseille.inserm.fr Two cDNA libraries were used, either derived from mixed stages worms, or from a normalized library, containing one representative of each expressed gene of the whole genome (ORFeome). BMC Genomics (null) 2006 Only protein-protein interactions imex curation popovici-2006-1 Direct and heterologous approaches to identify the LET-756/FGF interactome. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Popovici C., Berda Y., Conchonaud F., Harbis A., Birnbaum D., Roubin R. For the sequence name C15C8.3, two UniProt proteins were found ( Q18020 and E0AHB8) . The longer protein has been entered as both proteins have an identical sequence for aas 240 - end. roubin@marseille.inserm.fr Two cDNA libraries were used, either derived from mixed stages worms, or from a normalized library, containing one representative of each expressed gene of the whole genome (ORFeome). BMC Genomics (null) 2006 Only protein-protein interactions imex curation popovici-2006-6 Direct and heterologous approaches to identify the LET-756/FGF interactome. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Popovici C., Berda Y., Conchonaud F., Harbis A., Birnbaum D., Roubin R. anti-tag immunostaining RCF-2 (F58F6.4) has not been added as in interactor, as no mention is made of it in the text. roubin@marseille.inserm.fr Two cDNA libraries were used, either derived from mixed stages worms, or from a normalized library, containing one representative of each expressed gene of the whole genome (ORFeome). BMC Genomics (null) 2006 Only protein-protein interactions imex curation popovici-2006-5 Direct and heterologous approaches to identify the LET-756/FGF interactome. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Popovici C., Berda Y., Conchonaud F., Harbis A., Birnbaum D., Roubin R. KRAB100 has not been added as an interactor as it cannot be identified. roubin@marseille.inserm.fr Two cDNA libraries were used, either derived from mixed stages worms, or from a normalized library, containing one representative of each expressed gene of the whole genome (ORFeome). BMC Genomics (null) 2006 Only protein-protein interactions imex curation pal1_caeel Homeobox protein pal-1 pal-1 ceh-3 C38D4.6 Homeobox protein ceh-3 Posterior alae in males protein 1 Caudal homolog 1 protein protein caeel Caenorhabditis elegans MSVDVKSDFSENESSSTPSPTTVPADVTWPHYPMMPFMQPHPLREKMLQPTFDPQIYGRWSQMGDTGFYGHPDLYPFGLPQLAANGQIPAVEAVDVKPPLSNGSSSSDSGMYPSPSDMMTPFPSTSSGAASSSELSAAAAAAANYQMRAATCYQQSVWPFMDYQQFQGFSWKMPLGNNHGKDRRSSSDGKTLPTGPGTNNVRVRTADKYRMVYSDYQRLELEKEFHTSPFITSDRKSQLSTMLSLTERQIKIWFQNRRAKDRRDKQKIRL le756_caeel Protein let-756 let-756 Lethal protein 756 C05D11.4 protein protein caeel Caenorhabditis elegans MAVPAASSIVSYGGAATSNFLTTPVTPFLAGFYNSNFVTDRINSCAPYRVDRIRKQLQDEEENGYPPADDRRRGALFCRSGTWLEMLPIENPDDGSTRVKVHGTKEESSKFSIVEFVSVAMSLVSIRGVETKNFICMDPSGKLYATPSSNYSTECVFLEEMMENYYNLYASCAYGDRFNPWYIELRRSGKPRRGPNSKKRRKASHFLVVHHDLDRLRSPVPNGNDVTDLVVASLFHQPPSHPLFRQQTVTKPPNPHRISNLRAKVEMTNQAEKQRLLEEKKRRREKKKRRREDRLRKEEQIREARRQELKSLREEELRRRYQQQQQQQASTQTRYNRPQNPANPYPTYRPLPTRSTVQSPRPAYNPYWQSPVTQAPHHNSHHHHHHHPRVSSSSDPQQRHQSQQHYLAQTVSNPNRQNVNYQRYP hsp90_caeel Heat shock protein 90 daf-21 Abnormal dauer formation protein 21 C47E8.5 protein protein caeel Caenorhabditis elegans MSENAETFAFQAEIAQLMSLIINTFYSNKEIYLRELISNASDALDKIRYQALTEPSELDTGKELFIKITPNKEEKTLTIMDTGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAFLVADKVVVTSKNNDDDSYQWESSAGGSFVVRPFNDPEVTRGTKIVMHIKEDQIDFLEERKIKEIVKKHSQFIGYPIKLVVEKEREKEVEDEEAVEAKDEEKKEGEVENVADDADKKKTKKIKEKYFEDEELNKTKPIWTRNPDDISNEEYAEFYKSLSNDWEDHLAVKHFSVEGQLEFRALLFVPQRAPFDLFENKKSKNSIKLYVRRVFIMENCEELMPEYLNFIKGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKCMELIDEVAEDKDNFKKFYEQFGKNLKLGIHEDSTNRKKLSDFLRYSTSAGDEPTSLKEYVSRMKENQTQIYYITGESKDVVAASAFVERVKSRGFEVLYMCDPIDEYCVQQLKEYDGKKLVSVTKEGLELPETEEEKKKFEEDKVAYENLCKVIKDILEKKVEKVGVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHAIMKTLRDRVEVDKNDKTVKDLVVLLFETALLASGFSLEEPQSHASRIYRMIKLGLDIGDDEIEDSAVPSSCTAEAKIEGAEEDASRMEEVD rs16_caeel 40S ribosomal protein S16 rps-16 T01C3.6 protein protein caeel Caenorhabditis elegans MTSTVQSVQTFGRKKTATAVAHCKKGQGLIKVNGRPLEFLEPQILRIKLQEPLLLVGKERFQDVDIRIRVSGGGHVAQIYAVRQALAKALVAYYHKYVDEQSKRELKNIFAAYDKSLLVADPRRRESKKFGGPGARARYQKSYR q21556_caeel M18.1 col-129 CELE_M18.1 protein protein caeel Caenorhabditis elegans MSTARYLVSIAAAASTFAVLASIVSLVYLVNDVNNYYDDVTRNIENFKDDANTVWHQMMTVVPQGGKQRQVYESLFGRTKRQAAQCNCGANSAASNCPAGPPGPPGAPGEDGDHGLVGEDGTPGADGNLGVPLSANGCIVCPAGPPGPPGQPGQNGQRGSDGQPGQDAMGGGQGAPGPQGPAGDNGQPGRPGNDGRPGAPGAPGTRSVGRPGTAGSPGPQGPPGQNGNDGQPGNDGAPGQPGQPGPDGHPGQPGNAGPPGTPGAAGQPGGDAAYCPCPSRSSVVRAQAAVARNRHVAARHRSVSRRKAVAARRSKARRVVAAKHRAVAKRHRAVQKA g5edd8_caeel Skp1-related protein skr-2 CELE_F46A9.4 F46A9.4 protein protein caeel Caenorhabditis elegans MADQKEASEAAKNREIKISSSDDEIFLVPRNVIRLSNTLNTLLVDLGLDDDEGTNAEPIPVQNVTASILKKVINWCTKHQSDPIPTEDSEKKTDGSIQDWDKKFLDIDQGTLFELILAANYLDIKGLLDVACQSVANMIKGKSPDEIRRAFNIKDDFTAEEREQIRKENAWCDD q9xvt3_caeel C15C6.2 CELE_C15C6.2 protein protein caeel Caenorhabditis elegans MSCVQQQRRSTGLRIAERLNKYITLPNRHSFTVDSKDVFQRGQVLSYIRSKAPFLLEHISEAKERLITVTSRGLMIIYENDDHGLVIDLRSARNVLCTADRSKKQRHFRCHIKIRMQRGNVHLFVGHNDVHKWTCAIMRAAGKCLPSTEPRDDGSLNVAMMTAVEDSGIFEEMSSTSSASYDYDEDDEVDEVKPTAIEQIPLPHVSVRSLRQKLEKELVLKPKEQVLAEQQHKANCDEPSFVSEIFCTPRAVFSDETVVLLEPTNARERREYEAQADRENQWWTRSLRC csk2a_caeel Casein kinase II subunit alpha B0205.7 kin-3 protein protein caeel Caenorhabditis elegans MPPIPSRARVYAEVNPSRPREYWDYEAHMIEWGQIDDYQLVRKLGRGKYSEVFEGFKMSTDEKVVVKILKPVKKKKIKREIKILENLRGGTNIITLLDVVKDPISRTPALIFEHVNNSDFKQLYQTLSDYDIRYYLYELLKALDFCHSQGIMHRDVKPHNVMIDAEKRELRLIDWGLAEFYHPRQDYNVRVASRYFKGPELLVDYQCYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTDELYEYIARYHIDLDPRFNDILGRHSRKRWERFIHAENQHLVTPEALDFLDKLLRYDHAERLTAQEAMGHEYFRPVVEAHARANGTEQADGQGASNSASSQSSDAKIDGA csk2b_caeel Casein kinase II subunit beta kin-10 kin-5 T01G9.6 protein protein caeel Caenorhabditis elegans MSSSEEVSWITWFCGLRGNEFFCEVDEEYIQDRFNLTGLNEQVPKYRQALDMILDLEPDDIEDNATNTDLVEQAAEMLYGLIHARYILTNRGISQMVEKWRDHDFGVCPRVYCENQPMLPIGLSDVPGEAMVKLYCPRCNDVFVPRSSRHQHTDGSYFGTGFPHMLFFVHPDLRPRRPVTQFVPKLYGFKIHPVAYGGQEGNSGGNTANNVAAAQNNTTPAGQQSGGQFNNYGL hsp6_caeel Heat shock protein hsp-6 hsp-6 hsp70f C37H5.8 Heat shock 70 kDa protein F, mitochondrial mot-2 protein protein caeel Caenorhabditis elegans MLSARSFLSSARTIARSSLMSARSLSDKPKGHVIGIDLGTTNSCVSIMEGKTPKVIENAEGVRTTPSTVAFTADGERLVGAPAKRQAVTNSANTLFATKRLIGRRYEDPEVQKDLKVVPYKIVKASNGDAWVEAQGKVYSPSQVGAFVLMKMKETAESYLGTTVNNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKDAGDKIIAVYDLGGGTFDVSILEIQKGVFEVKSTNGDTFLGGEDFDHALVHHLVGEFKKEQGVDLTKDPQAMQRLREAAEKAKCELSSTTQTDINLPYITMDQSGPKHLNLKLTRAKFEQIVGDLIKRTIEPCRKALHDAEVKSSQIADVLLVGGMSRMPKVQATVQEIFGKVPSKAVNPDEAVAMGAAIQGAVLAGDVTDVLLLDVTPLSLGIETLGGIMTKLITRNTTIPTKKSQVFSTAADGQTQVQIKVFQGEREMATSNKLLGQFSLVGIPPAPRGVPQVEVTFDIDANGIVNVSARDRGTGKEQQIVIQSSGGLSKDQIENMIKEAEKNAAEDAKRKELVEVINQAEGIIHDTEAKMTEFADQLPKDECEALRTKIADTKKILDNKDNETPEAIKEACNTLQQQSLKLFEAAYKNMAAKNSGGDAQEAKTAEEPKKEQN gslg1_caeel Golgi apparatus protein 1 homolog F14E5.2 protein protein caeel Caenorhabditis elegans MWRFPLILASVCWLTTAQQQNVANDPDKKLASFDACKADIHKHCSRPDVDLTSDMSILECLQDAGFSETATLSEQCEQLVWDFKVKITQDERFVSAAKQYCEEELKGNAAMNLCTSQTQPGFALSCLMEFTKNVTETGKCHAFLARTERLAFSDFRLVGPFVTKCRAILDKFKCNVLTPDPAHKGVRVAHTQGMALECILDKVVKNAKTQADALQILGDDCKHEVLRLAEMQADDFHLDRPLFFACRLDRERYCKDVPSGEGKVFECLMMNRNDKFMDPECGNLLAERAYLMGRDYRMAHPLTKACQPELTRYKCEPQNQIESAAHFHLAWILLCLENGANQPEHKEVQPSKECAHEMITHRQMMMQHFRMAPELVLNCAQEIDKWCSPRGDIEAEGRTLHCLMEHAESRNETLKLGAQCLQAVQQVVKVADIGRNYKVDKVLYGSCRSLIDGPCAQDAVSETATLTCLMRNVDSPDMVPECEKRLLEVQYFMARDWTMDPQLYEACHQEAVSRCSALDNWHQQHNSDNTVDRGPQVLACLYRSAYDEQNPLSVKCGTQVRQLLHVRAVRVNLIPEIEDSCREALSEFCSHNVKPSEEMMCLQQNFETDNFKRKHPQCFAELTKFTEMEAKDTKLNRALSKACKPVISTHCAQFANEEIDHGDVLECLVNNKDAKEMNNKCRSYVNHFELISLRDYHFSYKFQKACASDIEQSCKGHNNDKGEIIRCLSEVRFEHKVLGSPKDLTDDCKKQLKVAYLQQEQVEFDDKEHMADADPKLSQKCEQEIKMYKCNQADTFEDTIECLRLNFEHLGPECKSMIFYREKIEAVDNSMDDELQKKCRYDIGKFCANSDSENVLECLTNTKIVRLLQRECKAIVKERMQESARDVRLRPQLLTSCRKEAEQYCPEDMKKINMPQYSQTVLDGVVVSCLRDKFRQSISDQNHIDFSPRCSAEVSRAIVEAEFDPQLDPPLYNACKSTINDHCSATIMESGGHFDNVMECLKNDFNKGLIRDKQCSEQVARRLQESLVDIHLDPVLHEACAMDIQRYCRDVPPGHSRIVMCLMDSADKQELSKECSTKLSDRNKLWMKAHSEFQMALPDSWHAFANLVMEHPERNSILGYLAGFIVFILLIGCCCGRVSKKQYIEMKNR ebp2_caeel Probable rRNA-processing protein EBP2 homolog C18A3.3 protein protein caeel Caenorhabditis elegans MVRKMNKLAKRLASTSKSRQPEPESDSDGSEFDFDNAIEEKPMEAMDIEEVESDGDDDERELQAAFAAGLLKDGLNIQVAKKRPIINKSAEMKEKLAEITKDLPWVETLEVVTPHSEMDKKVENDDFQRELNFYKQAEKAVQIAYPRLLNLGIKVLRPTDYYAEMAKSDTHMQKVRKRLLGIQEMKERQEAFRRIREEKKFAVKVQKEVLAAKNTEKKNLAEAVKKHKKGMKQQLEDMLNNVKRHGLDQDDDAPTGAFGDRLGGRGGAGRGGAGRGGSMRNAGELKRKLKSDKFGYGGKKKGMKRNNKESFNDLFGAPRGGFGGRGRGGGRGGRGGRGRR rl6_caeel 60S ribosomal protein L6 rpl-6 R151.3 protein protein caeel Caenorhabditis elegans MVGKRNLPVISRNFDLSPGVLRFSASRLRLKKGEKKPKFTKDTSAKLPKLQRNGTKFALGHSKTVTLRKTLTPGTVLIVLAGRHKGKRVVFLKQLPQSGLLLVTGPHKINGFPLRRIGQAFVIATSLKVNVSGVKIPEHINDEYFKRKSTAQKTGKNIFASGKTEYTVSEQRKKDIKTVDAPILAAIKKHPEHKFLFGYLGTRFSLGKNQYPHKMQF 14331_caeel 14-3-3-like protein 1 par-5 ftt-1 M117.2 Partitioning defective protein 5 protein protein caeel Caenorhabditis elegans MSDTVEELVQRAKLAEQAERYDDMAAAMKKVTEQGQELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQQLAKEYRVKVEQELNDICQDVLKLLDEFLIVKAGAAESKVFYLKMKGDYYRYLAEVASEDRAAVVEKSQKAYQEALDIAKDKMQPTHPIRLGLALNFSVFYYEILNTPEHACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDVGAEDQEQEGNQEAGN 14332_caeel 14-3-3-like protein 2 ftt-2 F52D10.3 protein protein caeel Caenorhabditis elegans MSDGKEELVNRAKLAEQAERYDDMAASMKKVTELGAELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQQMAKEYREKVEKELRDICQDVLNLLDKFLIPKAGAAESKVFYLKMKGDYYRYLAEVASGDDRNSVVEKSQQSYQEAFDIAKDKMQPTHPIRLGLALNFSVFFYEILNAPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAATDDTDANETEGGN 1433b_human 14-3-3 protein beta/alpha YWHAB Protein kinase C inhibitor protein 1 Protein 1054 protein protein human Homo sapiens Human MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN umps_caeel Uridine 5'-monophosphate synthase umps-1 rad-6 T07C4.1 protein protein caeel Caenorhabditis elegans MSSLTDKTRNGALKRNLLRQMLKASVFKFGEFQLKSGQISPIYIDLRECFGHPGLLMLISEAISKQVEISEVQYAGVLGIPYAALPYASVAAGNYLKKPLLIVRKEAKSYGTKKLIEGLYQPNDRLILIEDVVTTGGSILDVVKVLHTENLVASDVFCILDREQGGRQKLQDAGVTLHSLLDMQTVLTFLYSTGAIGDEQWHGIVQALNLPYTSPTKLEINSELENLSSLPYVENVRTPLAERESLTESALIKKILGIMRRKKSNLCLAVDYTTVEQCLQMIELAGPFVLAIKLHADAITDFNEEFTRKLTTMANDMDFIIFEDRKFGDTGNTNLLQLTGAQKIANWADVVTVHAVQGSDSIAGVFRKLAKDPTYRLSGVLLIAQLSTKGSLTALEGYTETAVKIANENRDVISGFITQTRVSACSDLLNWTPGVNLDAKSDSAGQQWRGVDEAIEVQQNDIIIVGRGVTSSSEPVQQLKRYRQIAWDALTRSDDSI hrg7_caeel Aspartic protease 10 Heme transporter hrg-7 Heme-responsive gene 7 protein asp-10 C15C8.3 hrg-7 protein protein caeel Caenorhabditis elegans MKTFIALLALLTVVSAEVHQFNIGYRPNMRQRMNAKGKLAEYEKERNELLSKKSLQLASSSSPVIDYEDMAYMVQISLGSPAQNFVLFIDSGSSNLWVPDITCAGGKDATCGSYCKSTPYDACLTFCQEECCTKTVEGVKVLSTTDACQSKHRFNSSLSSSYVTNGQKFDMTYNTGEVKGFFGVDTFCFTNTSVCATGQVFGQATTIGEAFAKQPEDGIIGLGWPALAVNQQTPPLFNLMNQGKLDQPYFVVYLANIGPTSQINGGAFTVGGLDTTHCSSNVDWVPLSTQTFWQFKLGGVSSGSYSQAPNSGWQAAADTAASFIGAPKSVVTSLAKAVGATYVPLTGAFFMDCDAVVPDIVFTINGKTYNMPSTSFVVSAGPGPCMFAFYELTAGGFYPAWMLGPPFMRAYCHVHDMKSGRLGLAKVL q20000_caeel F35A5.4 CELE_F35A5.4 protein protein caeel Caenorhabditis elegans MQYLIAAFAVFQLSLGDEFSTSALTSPYLKMNGSLITRVRSKRQCCAMCPSGNCGCGSCSGFVTCPDRCQPMCTQACVMAKTSVCVDQCMPKCDSACINLVRSGPSCDQQCMPLCLPACINAIQGPTECAPQCMPSCSSNCIQQVFPSCPQQCQPVCTPQCIQSIQVAIQRPTCASSCMPSCSQSCIQKYEITVEQETCVPACMPACSSACVQAVTCSTCTNNCPSICSQANCIPQCMPRCLPTCIQQIQISVPLPPPAPRCDSMCMPSCSPSCVQQYSLCPQQCRPMCTNACVTNLQVSRPVSQCLPACMPSCTSSCVQSMCPQQCYPSCDMNCIQQYAVQMAPTPCAAQCMPLCESSCIARLSCVQTCMPACSPTCVQNYAAGPIQCAPACMPLCQPTCVQQHAEVVVACGVPCQCQPGYVQCSQNLCCLKYKNMAAKFRKLSGSTTNSNNNGNNGHNNGPNNNNDEDDEDNNSAGGSYTEPMRDSPKTSKSNSTSSEEKNSGKTLSAFSDTQMDGDSYAKA mbd1_human Methyl-CpG-binding domain protein 1 CXXC3 Methyl-CpG-binding protein MBD1 Protein containing methyl-CpG-binding domain 1 CXXC-type zinc finger protein 3 MBD1 PCM1 protein protein human Homo sapiens Human MAEDWLDCPALGPGWKRREVFRKSGATCGRSDTYYQSPTGDRIRSKVELTRYLGPACDLTLFDFKQGILCYPAPKAHPVAVASKKRKKPSRPAKTRKRQVGPQSGEVRKEAPRDETKADTDTAPASFPAPGCCENCGISFSGDGTQRQRLKTLCKDCRAQRIAFNREQRMFKRVGCGECAACQVTEDCGACSTCLLQLPHDVASGLFCKCERRRCLRIVERSRGCGVCRGCQTQEDCGHCPICLRPPRPGLRRQWKCVQRRCLRGKHARRKGGCDSKMAARRRPGAQPLPPPPPSQSPEPTEPHPRALAPSPPAEFIYYCVDEDELQPYTNRRQNRKCGACAACLRRMDCGRCDFCCDKPKFGGSNQKRQKCRWRQCLQFAMKRLLPSVWSESEDGAGSPPPYRRRKRPSSARRHHLGPTLKPTLATRTAQPDHTQAPTKQEAGGGFVLPPPGTDLVFLREGASSPVQVPGPVAASTEALLQEAQCSGLSWVVALPQVKQEKADTQDEWTPGTAVLTSPVLVPGCPSKAVDPGLPSVKQEPPDPEEDKEENKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRDTAVWLPRSKDLKKPGARKQ eif3i_human Eukaryotic translation initiation factor 3 subunit I EIF3I TRIP1 EIF3S2 Eukaryotic translation initiation factor 3 subunit 2 eIF-3-beta eIF3 p36 TGF-beta receptor-interacting protein 1 protein protein human Homo sapiens Human MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDADWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQCFVSFFDLRDPSQIDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTFRTERPVNSAALSPNYDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEFEA fbli1_human Filamin-binding LIM protein 1 FBLIM1 FBLP1 Migfilin Mitogen-inducible 2-interacting protein protein protein human Homo sapiens Human MASKPEKRVASSVFITLAPPRRDVAVAEEVRQAVCEARRGRPWEAPAPMKTPEAGLAGRPSPWTTPGRAAATVPAAPMQLFNGGCPPPPPVLDGEDVLPDLDLLPPPPPPPPVLLPSEEEAPAPMGASLIADLEQLHLSPPPPPPQAPAEGPSVQPGPLRPMEEELPPPPAEPVEKGASTDICAFCHKTVSPRELAVEAMKRQYHAQCFTCRTCRRQLAGQSFYQKDGRPLCEPCYQDTLERCGKCGEVVRDHIIRALGQAFHPSCFTCVTCARCIGDESFALGSQNEVYCLDDFYRKFAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDCRILLSVEPTDQGCYPLNNHLFCKPCHVKRSAAGCC le756-pal_1-1 1131148 n/a 1131153 unspecified role unspecified role prey prey n/a 1131154 unspecified role unspecified role bait bait physical association physical association false false false Table 2A PAL-1 interacted strongly with LET-756 (two positive tests). For the other interactors, only one test was clearly positive (Table 2A). le756-daf_21-1 1131148 n/a 1131155 unspecified role unspecified role prey prey n/a 1131154 unspecified role unspecified role bait bait physical association physical association false false false Table 2A PAL-1 interacted strongly with LET-756 (two positive tests). For the other interactors, only one test was clearly positive (Table 2A). le756-rs16-1 1131148 n/a 1131156 unspecified role unspecified role prey prey n/a 1131154 unspecified role unspecified role bait bait physical association physical association false false false Table 2A PAL-1 interacted strongly with LET-756 (two positive tests). For the other interactors, only one test was clearly positive (Table 2A). le756-q21556-1 1131148 n/a 1131154 unspecified role unspecified role bait bait n/a 1131157 unspecified role unspecified role prey prey physical association physical association false false false Table 2A PAL-1 interacted strongly with LET-756 (two positive tests). For the other interactors, only one test was clearly positive (Table 2A). le756-skr_2-1 1131148 n/a 1131154 unspecified role unspecified role bait bait n/a 1131158 unspecified role unspecified role prey prey physical association physical association false false false Table 2A PAL-1 interacted strongly with LET-756 (two positive tests). For the other interactors, only one test was clearly positive (Table 2A). le756-q9xvt3-1 1131148 n/a 1131159 unspecified role unspecified role prey prey n/a 1131154 unspecified role unspecified role bait bait physical association physical association false false false Table 2A PAL-1 interacted strongly with LET-756 (two positive tests). For the other interactors, only one test was clearly positive (Table 2A). le756-kin_3 1131148 n/a 1131160 unspecified role unspecified role prey prey n/a 1131154 unspecified role unspecified role bait bait physical association physical association false false false TABLE 2B le756-kin_10-2 1131148 n/a 1131161 unspecified role unspecified role prey prey n/a 1131154 unspecified role unspecified role bait bait physical association physical association false false false TABLE 2B let56-hsp6 1131148 n/a 1131154 unspecified role unspecified role bait bait n/a 1131162 unspecified role unspecified role prey prey physical association physical association false false false TABLE 2B let56-glg1 1131148 n/a 1131163 unspecified role unspecified role prey prey n/a 1131154 unspecified role unspecified role bait bait physical association physical association false false false TABLE 2B let56-nobp 1131148 n/a 1131164 unspecified role unspecified role prey prey n/a 1131154 unspecified role unspecified role bait bait physical association physical association false false false TABLE 2B let-rpl-6 1131148 n/a 1131165 unspecified role unspecified role prey prey n/a 1131154 unspecified role unspecified role bait bait physical association physical association false false false TABLE 2B let756-par-5 1131148 n/a 1131166 unspecified role unspecified role prey prey n/a 1131154 unspecified role unspecified role bait bait physical association physical association false false false TABLE 2C let756-ftt2 1131148 n/a 1131154 unspecified role unspecified role bait bait n/a 1131167 unspecified role unspecified role prey prey physical association physical association false false false TABLE 2C let-756 1131149 n/a 1131160 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1131154 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 1 let_756-gslg1 1131149 n/a 1131154 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 2 let756-1 1131149 n/a 1131154 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1131161 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 1 let756-2 1131149 n/a 1131154 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1131156 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false let756-3 1131149 n/a 1131155 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1131154 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 1 let756-5 1131149 n/a 1131157 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1131154 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 1 let756-6 1131149 n/a 1131154 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1131158 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 1 let756-rpl6 1131149 n/a 1131165 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1131154 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 1 let756-c18 1131149 n/a 1131164 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1131154 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 1 let756-ftt1 1131149 n/a 1131166 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1131154 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 1 let756-ftt2-1 1131149 n/a 1131154 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1131167 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 1 let756-ywhab-1 1131149 n/a 1131168 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1131154 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 1 le756-pal_1 1131150 n/a 1131153 unspecified role unspecified role prey prey n/a 1131154 unspecified role unspecified role bait bait physical association physical association false false false Table 1 le756-daf_21 1131150 n/a 1131155 unspecified role unspecified role prey prey n/a 1131154 unspecified role unspecified role bait bait physical association physical association false false false Table 1 le756-rs16 1131150 n/a 1131156 unspecified role unspecified role prey prey n/a 1131154 unspecified role unspecified role bait bait physical association physical association false false false Table 1 le756-umps_1 1131150 n/a 1131169 unspecified role unspecified role prey prey n/a 1131154 unspecified role unspecified role bait bait physical association physical association false false false Table 1 le756-q18020 1131150 n/a 1131170 unspecified role unspecified role prey prey n/a 1131154 unspecified role unspecified role bait bait physical association physical association false false false Table 1 le756-q9xvt3 1131150 n/a 1131159 unspecified role unspecified role prey prey n/a 1131154 unspecified role unspecified role bait bait physical association physical association false false false Table 1 le756-q21556 1131150 n/a 1131157 unspecified role unspecified role prey prey n/a 1131154 unspecified role unspecified role bait bait physical association physical association false false false Table 1 le756-q20000 1131150 n/a 1131171 unspecified role unspecified role prey prey n/a 1131154 unspecified role unspecified role bait bait physical association physical association false false false Table 1 le756-skr_2 1131150 n/a 1131158 unspecified role unspecified role prey prey n/a 1131154 unspecified role unspecified role bait bait physical association physical association false false false Table 1 let_756-pal_1-1 1131151 n/a 1131153 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1131154 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig 2 kin_3-let_756 1131151 n/a 1131154 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1131160 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig 2 gslg1-let_756 1131151 n/a 1131154 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1131163 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig 2 kin_10-let_756 1131151 n/a 1131154 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1131161 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig 2 KIN-10 was present in nucleoplasm of untransfected LET-756 cells and moved with LET-756 into the nuclear speckles when co-transfected. Upon actinomycin D treatment both LET-756 and KIN-10 formed enlarged speckles and moved to the nucleolus. col_129-let_756 1131151 n/a 1131157 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1131154 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig 2 let_756-rpl_6-1 1131151 n/a 1131165 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1131154 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig 2 let_756-rps_16-1 1131151 n/a 1131154 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1131156 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig 2 let_756-par_5 1131151 n/a 1131166 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1131154 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig 2 ftt_2-let_756 1131151 n/a 1131154 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1131167 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig 2 let756-ywhab 1131152 n/a 1131168 unspecified role unspecified role prey prey n/a 1131154 unspecified role unspecified role bait bait physical association physical association false false false TABLE 3A let756-mbd1 1131152 n/a 1131154 unspecified role unspecified role bait bait n/a 1131172 unspecified role unspecified role prey prey physical association physical association false false false TABLE 3A let756-eif3 1131152 n/a 1131154 unspecified role unspecified role bait bait n/a 1131173 unspecified role unspecified role prey prey physical association physical association false false false TABLE 3A let756-fbpl1 1131152 n/a 1131174 unspecified role unspecified role prey prey n/a 1131154 unspecified role unspecified role bait bait physical association physical association false false false TABLE 3A