UniProt UniProt http://www.uniprot.org luo-2006-1 Jab1, a novel protease-activated receptor-2 (PAR-2)-interacting protein, is involved in PAR-2-induced activation of activator protein-1. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Luo W., Wang Y., Hanck T., Stricker R., Reiser G. georg.reiser@medizin.uni-magdeburg.de human brain cDNA library J. Biol. Chem. (0021-9258) 2006 mimix curation luo-2006-2 Jab1, a novel protease-activated receptor-2 (PAR-2)-interacting protein, is involved in PAR-2-induced activation of activator protein-1. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Luo W., Wang Y., Hanck T., Stricker R., Reiser G. georg.reiser@medizin.uni-magdeburg.de J. Biol. Chem. (0021-9258) 2006 mimix curation luo-2006-3 Jab1, a novel protease-activated receptor-2 (PAR-2)-interacting protein, is involved in PAR-2-induced activation of activator protein-1. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Luo W., Wang Y., Hanck T., Stricker R., Reiser G. georg.reiser@medizin.uni-magdeburg.de J. Biol. Chem. (0021-9258) 2006 mimix curation luo-2006-4 Jab1, a novel protease-activated receptor-2 (PAR-2)-interacting protein, is involved in PAR-2-induced activation of activator protein-1. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Luo W., Wang Y., Hanck T., Stricker R., Reiser G. georg.reiser@medizin.uni-magdeburg.de J. Biol. Chem. (0021-9258) 2006 mimix curation luo-2006-5 Jab1, a novel protease-activated receptor-2 (PAR-2)-interacting protein, is involved in PAR-2-induced activation of activator protein-1. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Luo W., Wang Y., Hanck T., Stricker R., Reiser G. georg.reiser@medizin.uni-magdeburg.de J. Biol. Chem. (0021-9258) 2006 mimix curation luo-2006-6 Jab1, a novel protease-activated receptor-2 (PAR-2)-interacting protein, is involved in PAR-2-induced activation of activator protein-1. human-astrocyte Homo sapiens astrocyte astrocyte Astrocytes [Brain astrocytes; Astroglia] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Luo W., Wang Y., Hanck T., Stricker R., Reiser G. georg.reiser@medizin.uni-magdeburg.de J. Biol. Chem. (0021-9258) 2006 mimix curation luo-2006-7 Jab1, a novel protease-activated receptor-2 (PAR-2)-interacting protein, is involved in PAR-2-induced activation of activator protein-1. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. confocal microscopy confocal microscopy immunostaining immunostaining Luo W., Wang Y., Hanck T., Stricker R., Reiser G. georg.reiser@medizin.uni-magdeburg.de J. Biol. Chem. (0021-9258) 2006 mimix curation luo-2006-8 Jab1, a novel protease-activated receptor-2 (PAR-2)-interacting protein, is involved in PAR-2-induced activation of activator protein-1. human-astrocyte Homo sapiens astrocyte astrocyte Astrocytes [Brain astrocytes; Astroglia] confocal microscopy confocal microscopy immunostaining immunostaining Luo W., Wang Y., Hanck T., Stricker R., Reiser G. georg.reiser@medizin.uni-magdeburg.de J. Biol. Chem. (0021-9258) 2006 mimix curation csn5_human COP9 signalosome complex subunit 5 Jun activation domain-binding protein 1 COPS5 CSN5 JAB1 protein protein human Homo sapiens Human MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS par2_human Proteinase-activated receptor 2 F2RL1 GPR11 PAR2 Coagulation factor II receptor-like 1 G-protein coupled receptor 11 Thrombin receptor-like 1 protein protein human Homo sapiens Human MRSPSAAWLLGAAILLAASLSCSGTIQGTNRSSKGRSLIGKVDGTSHVTGKGVTVETVFSVDEFSASVLTGKLTTVFLPIVYTIVFVVGLPSNGMALWVFLFRTKKKHPAVIYMANLALADLLSVIWFPLKIAYHIHGNNWIYGEALCNVLIGFFYGNMYCSILFMTCLSVQRYWVIVNPMGHSRKKANIAIGISLAIWLLILLVTIPLYVVKQTIFIPALNITTCHDVLPEQLLVGDMFNYFLSLAIGVFLFPAFLTASAYVLMIRMLRSSAMDENSEKKRKRAIKLIVTVLAMYLICFTPSNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKSSSYSSSSTTVKTSY f2rl1-cops5-1 1167305 n/a 1167313 unspecified role unspecified role prey prey n/a 1167314 unspecified role unspecified role bait bait physical association physical association false false false no figure f2rl1-cops5 1167306 n/a 1167314 unspecified role unspecified role bait bait n/a 1167313 unspecified role unspecified role prey prey physical association physical association false false false no figure f2rl1-cops5-2 1167307 n/a 1167313 unspecified role unspecified role prey prey n/a 1167314 unspecified role unspecified role bait bait spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association false false false 2 f2rl1-cops5-3 1167308 n/a 1167313 unspecified role unspecified role prey prey n/a 1167314 unspecified role unspecified role bait bait physical association physical association false false false 3a and c, 6 and 7 PAR-2 peptide agonist PAR-2 AP, f2rl1-cops5-4 1167309 n/a 1167314 unspecified role unspecified role bait bait n/a 1167313 unspecified role unspecified role prey prey physical association physical association false false false 3b f2rl1-cops5-5 1167310 n/a 1167314 unspecified role unspecified role bait bait n/a 1167313 unspecified role unspecified role prey prey physical association physical association false false false 5a cops5-f2rl1 1167311 n/a 1167313 unspecified role unspecified role neutral component neutral component n/a 1167314 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 4 cops5-f2rl1-1 1167312 n/a 1167314 unspecified role unspecified role neutral component neutral component n/a 1167313 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 5