UniProt UniProt http://www.uniprot.org zhang-2005f-4 Chaperoned ubiquitylation--crystal structures of the CHIP U box E3 ubiquitin ligase and a CHIP-Ubc13-Uev1a complex. in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Zhang M., Windheim M., Roe SM., Peggie M., Cohen P., Prodromou C., Pearl LH. laurence.pearl@icr.ac.uk Mol. Cell (1097-2765) 2005 mimix curation zhang-2005f-6 Chaperoned ubiquitylation--crystal structures of the CHIP U box E3 ubiquitin ligase and a CHIP-Ubc13-Uev1a complex. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhang M., Windheim M., Roe SM., Peggie M., Cohen P., Prodromou C., Pearl LH. laurence.pearl@icr.ac.uk Mol. Cell (1097-2765) 2005 mimix curation zhang-2005f-1 Chaperoned ubiquitylation--crystal structures of the CHIP U box E3 ubiquitin ligase and a CHIP-Ubc13-Uev1a complex. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zhang M., Windheim M., Roe SM., Peggie M., Cohen P., Prodromou C., Pearl LH. laurence.pearl@icr.ac.uk Mol. Cell (1097-2765) 2005 mimix curation zhang-2005f-5 Chaperoned ubiquitylation--crystal structures of the CHIP U box E3 ubiquitin ligase and a CHIP-Ubc13-Uev1a complex. in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Zhang M., Windheim M., Roe SM., Peggie M., Cohen P., Prodromou C., Pearl LH. laurence.pearl@icr.ac.uk Mol. Cell (1097-2765) 2005 mimix curation zhang-2005f-2 Chaperoned ubiquitylation--crystal structures of the CHIP U box E3 ubiquitin ligase and a CHIP-Ubc13-Uev1a complex. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down western blot western blot Immuno blot Immuno blot Zhang M., Windheim M., Roe SM., Peggie M., Cohen P., Prodromou C., Pearl LH. laurence.pearl@icr.ac.uk Mol. Cell (1097-2765) 2005 mimix curation zhang-2005f-3 Chaperoned ubiquitylation--crystal structures of the CHIP U box E3 ubiquitin ligase and a CHIP-Ubc13-Uev1a complex. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Zhang M., Windheim M., Roe SM., Peggie M., Cohen P., Prodromou C., Pearl LH. laurence.pearl@icr.ac.uk Mol. Cell (1097-2765) 2005 mimix curation ub2v1_human Ubiquitin-conjugating enzyme E2 variant 1 CROC-1 TRAF6-regulated IKK activator 1 beta Uev1A P/OKcl.19 UBE2V1 CROC1 UBE2V UEV1 protein protein human Homo sapiens Human MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN ube2n_human Ubiquitin-conjugating enzyme E2 N Ubiquitin-protein ligase N Ubiquitin carrier protein N Ubc13 Bendless-like ubiquitin-conjugating enzyme UBE2N BLU UbcH13 E2 ubiquitin-conjugating enzyme N protein protein human Homo sapiens Human MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI chip_human E3 ubiquitin-protein ligase CHIP CHIP STUB1 PP1131 Carboxy terminus of Hsp70-interacting protein STIP1 homology and U box-containing protein 1 CLL-associated antigen KW-8 Antigen NY-CO-7 RING-type E3 ubiquitin transferase CHIP protein protein human Homo sapiens Human MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY hs90a_human Heat shock protein HSP 90-alpha HSP90AA1 HSP90A HSPC1 Heat shock 86 kDa Renal carcinoma antigen NY-REN-38 HSPCA Lipopolysaccharide-associated protein 2 protein protein human Homo sapiens Human MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKCLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTSRMEEVD chip_mouse E3 ubiquitin-protein ligase CHIP Carboxy terminus of Hsp70-interacting protein Stub1 Chip RING-type E3 ubiquitin transferase CHIP STIP1 homology and U box-containing protein 1 protein protein mouse Mus musculus Mouse MKGKEEKEGGARLGTGGGGSPDKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLTRLIAAERERELEECQRNHEGHEDDGHIRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY ube2n_mouse Ubiquitin-conjugating enzyme E2 N Ubiquitin-protein ligase N Ubiquitin carrier protein N Ubc13 Bendless-like ubiquitin-conjugating enzyme E2 ubiquitin-conjugating enzyme N Ube2n Blu protein protein mouse Mus musculus Mouse MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI ube2n-ube2v1-2 1141850 n/a 1141856 unspecified role unspecified role prey prey n/a 1141857 unspecified role unspecified role bait bait direct interaction direct interaction false false false fig 5B ube2v1-ube2n-2 1141850 n/a 1141857 unspecified role unspecified role prey prey n/a 1141856 unspecified role unspecified role bait bait direct interaction direct interaction false false false fig 5B ube2v1-stub1 1141850 n/a 1141857 unspecified role unspecified role prey prey n/a 1141858 unspecified role unspecified role prey prey n/a 1141856 unspecified role unspecified role bait bait association association false false false fig 5B ube2n-stub1 1141850 n/a 1141858 unspecified role unspecified role prey prey n/a 1141857 unspecified role unspecified role bait bait direct interaction direct interaction false false false fig 5B ube2n-ube2v1-1 1141851 n/a 1141858 unspecified role unspecified role prey prey n/a 1141857 unspecified role unspecified role bait bait physical association physical association false false false fig 5A hsp90aa1-stub1-2 1141851 n/a 1141859 unspecified role unspecified role bait bait n/a 1141858 unspecified role unspecified role prey prey direct interaction direct interaction false false false fig 7E hsp90aa1-stub1-3 1141851 n/a 1141859 unspecified role unspecified role bait bait n/a 1141858 unspecified role unspecified role prey prey n/a 1141857 unspecified role unspecified role prey prey association association false false false fig 7E hsp90aa1-stub1 1141852 n/a 1141860 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 n/a 1141859 unspecified role unspecified role neutral component neutral component direct interaction direct interaction false false false fig 2 stub1-ube2n-4 1141852 n/a 1141861 unspecified role unspecified role neutral component neutral component n/a 1141860 unspecified role unspecified role neutral component neutral component n/a 1141856 unspecified role unspecified role neutral component neutral component physical association physical association false false false fig6 stub1-ube2n-5 1141853 n/a 1141857 unspecified role unspecified role prey prey Stoichiometry: 1.0 n/a 1141860 unspecified role unspecified role bait bait Stoichiometry: 2.0 direct interaction direct interaction false false false fig 7B ube2n-stub1-2 1141853 n/a 1141857 unspecified role unspecified role bait bait Stoichiometry: 1.0 n/a 1141860 unspecified role unspecified role prey prey Stoichiometry: 2.0 direct interaction direct interaction false false false fig 7C ube2v1-stub1-1 1141854 n/a 1141857 unspecified role unspecified role prey prey n/a 1141856 unspecified role unspecified role bait bait n/a 1141858 unspecified role unspecified role prey prey physical association physical association false false false fig 5C ube2n-stub1-1 1141855 n/a 1141856 unspecified role unspecified role neutral component neutral component human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 1141858 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 1141857 unspecified role unspecified role bait bait physical association physical association false false false fig 5A