MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint fernandes-2004-1 Identification of a protein that interacts with the golli-myelin basic protein and with nuclear LIM interactor in the nervous system. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Fernandes AO., Campagnoni CW., Kampf K., Feng JM., Handley VW., Schonmann V., Bongarzone ER., Reyes S., Campagnoni AT. J. Neurosci. Res. (0360-4012) 2004 partial coverage rapid curation ctds1_mouse Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 Ctdsp1 Nif3 Nliif Small C-terminal domain phosphatase 1 Nuclear LIM interactor-interacting factor 3 Golli-interacting protein protein protein mouse Mus musculus Mouse MDSSAVITQISKEEARGPLRGKGDQKSAVSQKPRSRGILHSLFCCVCRDDGEPLPAHSGAPLLVEENGAIPKHTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQPRPGS mint homomint ctds1_human Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 SCP1 Nuclear LIM interactor-interacting factor 3 CTDSP1 NIF3 NLIIF Small C-terminal domain phosphatase 1 protein protein human Homo sapiens Human MDSSAVITQISKEEARGPLRGKGDQKSAASQKPRSRGILHSLFCCVCRDDGEALPAHSGAPLLVEENGAIPKQTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQPRPGS ctdsp1-ctdsp1 1230978 ctds1_mouse 1230979 unspecified role unspecified role bait bait ctds1_human 1230980 unspecified role unspecified role prey prey direct interaction direct interaction false false false f3c homomint mint ctdsp1-ctdsp1-1 1230978 ctds1_mouse 1230979 unspecified role unspecified role bait bait ctds1_human 1230980 unspecified role unspecified role prey prey physical association physical association false false false f5b homomint mint