IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ paces_fessy-2004-1 The negative regulator of Gli, Suppressor of fused (Sufu), interacts with SAP18, Galectin3 and other nuclear proteins. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Paces-Fessy M., Boucher D., Petit E., Paute-Briand S., Blanchet-Tournier MF. sufu_mouse was identified from tag fluorescence; leg3_mouse and sap18_mouse were identified by immunofluorescence. Fig. 6. blanchet@ijm.jussieu.fr Biochem. J. (0264-6021) 2004 Only protein-protein interactions imex curation Curated by Carol from InnateDB paces_fessy-2004-6 The negative regulator of Gli, Suppressor of fused (Sufu), interacts with SAP18, Galectin3 and other nuclear proteins. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Paces-Fessy M., Boucher D., Petit E., Paute-Briand S., Blanchet-Tournier MF. sufu_mouse was identified from tag fluorescence; leg3_mouse and sap18_mouse were identified by immunofluorescence. Fig. 6. blanchet@ijm.jussieu.fr Mouse embryonic 3T3 fibroblast cDNA Biochem. J. (0264-6021) 2004 Only protein-protein interactions imex curation Curated by Carol from InnateDB paces_fessy-2004-4 The negative regulator of Gli, Suppressor of fused (Sufu), interacts with SAP18, Galectin3 and other nuclear proteins. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Paces-Fessy M., Boucher D., Petit E., Paute-Briand S., Blanchet-Tournier MF. sufu_mouse was identified from tag fluorescence; leg3_mouse and sap18_mouse were identified by immunofluorescence. Fig. 6. blanchet@ijm.jussieu.fr Biochem. J. (0264-6021) 2004 Only protein-protein interactions imex curation Curated by Carol from InnateDB paces_fessy-2004-2 The negative regulator of Gli, Suppressor of fused (Sufu), interacts with SAP18, Galectin3 and other nuclear proteins. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Paces-Fessy M., Boucher D., Petit E., Paute-Briand S., Blanchet-Tournier MF. sufu_mouse was identified from tag fluorescence; leg3_mouse and sap18_mouse were identified by immunofluorescence. Fig. 6. blanchet@ijm.jussieu.fr Biochem. J. (0264-6021) 2004 Only protein-protein interactions imex curation Curated by Carol from InnateDB paces_fessy-2004-3 The negative regulator of Gli, Suppressor of fused (Sufu), interacts with SAP18, Galectin3 and other nuclear proteins. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Paces-Fessy M., Boucher D., Petit E., Paute-Briand S., Blanchet-Tournier MF. Interaction evidence was vague in the corresponding figure - lane 3 showing the pull down, the leg3 band is very faint. Interaction was stated in the text by authors. sufu_mouse was identified from tag fluorescence; leg3_mouse and sap18_mouse were identified by immunofluorescence. Fig. 6. blanchet@ijm.jussieu.fr Biochem. J. (0264-6021) 2004 Only protein-protein interactions imex curation Curated by Carol from InnateDB paces_fessy-2004-5 The negative regulator of Gli, Suppressor of fused (Sufu), interacts with SAP18, Galectin3 and other nuclear proteins. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Paces-Fessy M., Boucher D., Petit E., Paute-Briand S., Blanchet-Tournier MF. sufu_mouse was identified from tag fluorescence; leg3_mouse and sap18_mouse were identified by immunofluorescence. Fig. 6. blanchet@ijm.jussieu.fr Biochem. J. (0264-6021) 2004 Only protein-protein interactions imex curation Curated by Carol from InnateDB ci_drome Transcriptional activator cubitus interruptus ci ci-D CG2125 ci form of 155 kDa ci full-length protein protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDAYALPTYFPLAYSELQFLASRRAAAVAAAATVLPGSPCINQHHPTDVSSSVTVPSIIPTGGTSDSIKTSIQPQICNENTLLGNAGHQHNHQPQHVHNINVTGQPHDFHPAYRIPGYMEQLYSLQRTNSASSFHDPYVNCASAFHLAGLGLGSADFLGSRGLSSLGELHNAAVAAAAAGSLASTDFHFSVDGNRRLGSPRPPGGSIRASISRKRALSSSPYSDSFDINSMIRFSPNSLATIMNGSRGSSAASGSYGHISATALNPMSHVHSTRLQQIQAHLLRASAGLLNPMTPQQVAASGFSIGHMPTSASLRVNDVHPNLSDSHIQITTSPTVTKDVSQVPAAAFSLKNLDDAREKKGPFKDVVPEQPSSTSGGVAQVEADSASSQLSDRCYNNVVNNITGIPGDVKVNSRLDEYINCGSISIPSNEYDCANADTTDIKDEPGDFIETNCHWRSCRIEFITQDELVKHINNDHIQTNKKAFVCRWEDCTRGEKPFKAQYMLVVHMRRHTGEKPHKCTFEGCFKAYSRLENLKTHLRSHTGEKPYTCEYPGCSKAFSNASDRAKHQNRTHSNEKPYICKAPGCTKRYTDPSSLRKHVKTVHGAEFYANKKHKGLPLNDANSRLQQNNSRHNLQEHNIDSSPCSEDSHLGKMLGTSSPSIKSESDISSSNHHLVNGVRASDSLLTYSPDDLAENLNLDDGWNCDDDVDVADLPIVLRAMVNIGNGNASASTIGGSVLARQRFRGRLQTKGINSSTIMLCNIPESNRTFGISELNQRITELKMEPGTDAEIKIPKLPNTTIGGYTEDPLQNQTSFRNTVSNKQGTVSGSIQGQFRRDSQNSTASTYYGSMQSRRSSQSSQVSSIPTMRPNPSCNSTASFYDPISPGCSRRSSQMSNGANCNSFTSTSGLPVLNKESNKSLNACINKPNIGVQGVGIYNSSLPPPPSSHLIATNLKRLQRKDSEYHNFTSGRFSVPSYMHSLHIKNNKPVGENEFDKAIASNARRQTDPVPNINLDPLTNISRFSTTPHSFDINVGKTNNIASSINKDNLRKDLFTVSIKADMAMTSDQHPNERINLDEVEELILPDEMLQYLNLVKDDTNHLEKEHQAVPVGSNVSETIASNHYREQSNIYYTNKQILTPPSNVDIQPNTTKFTVQDKFAMTAVGGSFSQRELSTLAVPNEHGHAKCESFHHQSQKYMNTDIGSKQQSALPSAHQRQTEKSNYNQIIDSSMTSLPELNVDSIYPRNETENIFKVHGDHDNEIQCGIISQSQMSPSTNLNNDGQFSTVNMQPITTSKLFPPEPQKIVCDTQASNTSVMHLDTYQRTLEYVQSCQNWMETNNTSTNQIQSLPGMPVNNTLFPDVSSSTHPYHGTNMVINDMTTSLTSLLEENRYLQMMQ sufu_mouse Suppressor of fused homolog Sufu protein protein mouse Mus musculus Mouse MAELRPSVAPGPAAPPASGPSAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKYWLGGPDPLDYVSMYRNMGSPSANIPEHWHYISFGLSDLYGDNRVHEFTGTDGPSGFGFELTFRLKRETGESAPPTWPAELMQGLARYVFQSENTFCSGDHVSWHSPLDNSESRIQHMLLTEDPQMQPVRTPFGVVTFLQIVGVCTEELHSAQQWNGQGILELLRTVPIAGGPWLITDMRRGETIFEIDPHLQERVDKGIETDGSNLSGVSAKCAWDDLSRPPEDEEDSRSICLGTQPRRLSGKDTEQIRETLRRGLEINSKPVLPPINSQRQNGLTHDRAPSRKDSLGSDSSTAIIPHELIRTRQLESVHLKFNQESGALIPLCLRGRLLHGRHFTYKSITGDMAITFVSTGVEGAFATEEHPYAAHGPWLQILLTEEFVEKMLEDLEDLTSPEEFKLPKEYSWPEKKLKVSILPDVVFDSPLH gli1_human Zinc finger protein GLI1 GLI1 GLI Glioma-associated oncogene Oncogene GLI protein protein human Homo sapiens Human MFNSMTPPPISSYGEPCCLRPLPSQGAPSVGTEGLSGPPFCHQANLMSGPHSYGPARETNSCTEGPLFSSPRSAVKLTKKRALSISPLSDASLDLQTVIRTSPSSLVAFINSRCTSPGGSYGHLSIGTMSPSLGFPAQMNHQKGPSPSFGVQPCGPHDSARGGMIPHPQSRGPFPTCQLKSELDMLVGKCREEPLEGDMSSPNSTGIQDPLLGMLDGREDLEREEKREPESVYETDCRWDGCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKPHKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNEKPYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRAPSISTVEPKREREGGPIREESRLTVPEGAMKPQPSPGAQSSCSSDHSPAGSAANTDSGVEMTGNAGGSTEDLSSLDEGPCIAGTGLSTLRRLENLRLDQLHQLRPIGTRGLKLPSLSHTGTTVSRRVGPPVSLERRSSSSSSISSAYTVSRRSSLASPFPPGSPPENGASSLPGLMPAQHYLLRARYASARGGGTSPTAASSLDRIGGLPMPPWRSRAEYPGYNPNAGVTRRASDPAQAADRPAPARVQRFKSLGCVHTPPTVAGGGQNFDPYLPTSVYSPQPPSITENAAMDARGLQEEPEVGTSMVGSGLNPYMDFPPTDTLGYGGPEGAAAEPYGARGPGSLPLGPGPPTNYGPNPCPQQASYPDPTQETWGEFPSHSGLYPGPKALGGTYSQCPRLEHYGQVQVKPEQGCPVGSDSTGLAPCLNAHPSEGPPHPQPLFSHYPQPSPPQYLQSGPYTQPPPDYLPSEPRPCLDFDSPTHSTGQLKAQLVCNYVQSQQELLWEGGGREDAPAQEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYPTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQRGSSGHTPPPSGPPNMAVGNMSVLLRSLPGETEFLNSSA leg3_mouse Galectin-3 Lgals3 35 kDa lectin Carbohydrate-binding protein 35 Galactose-specific lectin 3 IgE-binding protein L-34 galactoside-binding lectin Laminin-binding protein Lectin L-29 Mac-2 antigen protein protein mouse Mus musculus Mouse MADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGQPAPGAFPGQPGAPGAYPQCSGGYPAAGPYGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAMI q9vg38_drome Suppressor of fused homolog Su(fu) CG6054 Dmel\CG6054 SU(FU) SUFU Su(Fu) SuFu Sufu dSufu su(fu) sufu Dmel_CG6054 d Sufu protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAEANLDKKPEVKPPPGLKAIIDHLGQVYPNQPNPLQVTTLLKYWLGGQDPLDYISMYNYPGDVDRNVPPHWHYISFGLSDLHGDERVHLREEGVTRSGMGFELTFRLAKTEIELKQQIENPEKPQRPPTWPANLLQAIGRYCFQTGNGLCFGDNIPWRKSLDGSTTSKLQNLLVAQDPQLGCIDTPTGTVDFCQIVGVFDDELEQASRWNGRGVLNFLRQDMQTGGDWLVTNMDRQMSVFELFPETLLNLQDDLEKQGSDLAGVNADFTFRELKPTKEVKEEVDFQALSEKCANDENNRQLTDTQMKREEPSFPQSMSMSSNSLHKSCPLDFQAQAPNCISLDGIEITLAPGVAKYLLLAIKDRIRHGRHFTFKAQHLALTLVAESVTGSAVTVNEPYGVLGYWIQVLIPDELVPRLMEDFRSAGLDEKCEPKERLELEWPDKNLKLIIDQPEPVLPMSLDAAPLKM cos_drome Kinesin-like protein costa cos cos2 costal-2 Kinesin-like protein costal2 CG1708 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MEIPIQVAVRIFPHRELKDLLRSFGPTEPKKDAQAVDEGADSKDSEAQVPAAEKDNPSISETDPNGNAEQDSAADSKTIPDANGNDSGQKDYPDSAYCVQAIPISASALGLPSALPGGDPMDSIAAGLIQVGPHTVPVTHALPSSSSQEQVYHQTVFPLITLFLEGFDASVVTYGQRGQGKSYTLYGNVQDPTLTDSTEGVVQLCVRDIFSHISLHPERTYAINVGFVEICGGDVCDLLGMGNIHCTNVDAVFHWLQVGLSARQSLPAHTLFTLTLEQQWVSKEGLLQHRLSTASFSDLCGTERCGDQPPGRPLDAGLCMLEQVISTLTDPGLMYGVNGNIPYGQTTLTTLLKDSFGGRAQTLVILCVSPLEEHLPETLGNLQFAFKVQCVRNFVIMNTYSDDNTMIVQPAEPVPESNSSAGPLSQAGPGDNFGLQFAASQWSKLVTNAEGLFSKLIDSKLITEVEKEQIEEWLFLKQECEECLSSTEAMRQQKQLVPILEAEEPEDVNSEAANSESPNSDNENDTDNESHRPDLDDKIESLMEEFRDKTDALILEKHAEYLSKHPKAVMQSQDREIEAQPPEENGDDRKVSIGSRRRSVQPGASLSTAELAMLNRVASQQPPPPIDPESVVDPLESSSGEGIRQAALAAAAATAPIEQLQKKLRKLVAEIEGKQRQLREIEETIQVKQNIIAELVKNSDTRSHAKQRFHKKRAKLEAECDKAKKQLGKALVQGRDQSEIERWTTIIGHLERRLEDLSSMKHIAGESGQKVKKLQQSVGESRKQADDLQKKLRKECKLRCQMEAELAKLRESRETGKELVKAQGSPEQQGRQLKAVQARITHLNHILREKSDNLEEQPGPEQQETLRHEIRNLRGTRDLLLEERCHLDRKLKRDKVLTQKEERKLLECDEAIEAIDAAIEFKNEMITGHRSIDTSDRIQREKGEQMLMARLNRLSTEEMRTLLYKYFTKVIDLRDSSRKLELQLVQLERERDAWEWKERVLSNAVRQARLEGERNAVLLQRQHEMKLTLMLRHMAEETSASSASYGERALAPACVAPPVQASSDFDYDHFYKGGGNPSKALIKAPKPMPTGSALDKYKDKEQRSGRNIFAKFHVLTRYASAAAAGSSGSTAEESTALIESTTTATATTTSTTTTGAVGKVKDKALVSFRPEQLKRLMPAPTATKVTRQKNKIIIQDASRRN fused_drome Serine/threonine-protein kinase fused fu CG6551 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNRYAVSSLVGQGSFGCVYKATRKDDSKVVAIKVISKRGRATKELKNLRRECDIQARLKHPHVIEMIESFESKTDLFVVTEFALMDLHRYLSYNGAMGEEPARRVTGHLVSALYYLHSNRILHRDLKPQNVLLDKNMHAKLCDFGLARNMTLGTHVLTSIKGTPLYMAPELLAEQPYDHHADMWSLGCIAYESMAGQPPFCASSILHLVKMIKHEDVKWPSTLTSECRSFLQGLLEKDPGLRISWTQLLCHPFVEGRIFIAETQAEAAKESPFTNPEAKVKSSKQSDPEVGDLDEALAALDFGESRQENLTTSRDSINAIAPSDVEHLETDVEDNMQRVVVPFADLSYRDLSGVRAMPMVHQPVINSHTCFVSGNSNMILNHMNDNFDFQASLRGGGVAAKPIVAPTVRQSRSKDLEKRKLSQNLDNFSVRLGHSVDHEAQRKATEIATQEKHNQENKPPAEAISYANSQPPQQQPQQLKHSMHSTNEEKLSSDNTPPCLLPGWDSCDESQSPPIENDEWLAFLNRSVQELLDGELDSLKQHNLVSIIVAPLRNSKAIPRVLKSVAQLLSLPFVLVDPVLIVDLELIRNVYVDVKLVPNLMYACKLLLSHKQLSDSAASAPLTTGSLSRTLRSIPELTVEELETACSLYELVCHLVHLQQQFLTQFCDAVAILAASDLFLNFLTHDFRQSDSDAASVRLAGCMLALMGCVLRELPENAELVERIVFNPRLNFVSLLQSRHHLLRQRSCQLLRLLARFSLRGVQRIWNGELRFALQQLSEHHSYPALRGEAAQTLDEISHFTFFVT ncoa3_mouse Nuclear receptor coactivator 3 Ncoa3 Aib1 Pcip Rac3 Tram1 Amplified in breast cancer-1 protein homolog CBP-interacting protein Receptor-associated coactivator 3 Steroid receptor coactivator protein 3 Thyroid hormone receptor activator molecule 1 protein protein mouse Mus musculus Mouse MSGLGESSLDPLAAESRKRKLPCDAPGQGLVYSGEKWRREQESKYIEELAELISANLSDIDNFNVKPDKCAILKETVRQIRQIKEQGKTISSDDDVQKADVSSTGQGVIDKDSLGPLLLQALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYSILHEPRRKDFLNTYQNPQLMEFLGLMRTRDKKAPYILIVRMLMKTHDILEDVNASPETRQRYETMQCFALSQPRAMLEEGEDLQCCMICVARRVTAPFPSSPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRCIQRFFSLNDGQSWSQKRHYQEAYVHGHAETPVYRFSLADGTIVSAQTKSKLFRNPVTNDRHGFISTHFLQREQNGYRPNPIPQDKGIRPPAAGCGVSMSPNQNVQMMGSRTYGVPDPSNTGQMGGARYGASSSVASLTPGQSLQSPSSYQNSSYGLSMSSPPHGSPGLGPNQQNIMISPRNRGSPKMASHQFSPAAGAHSPMGPSGNTGSHSFSSSSLSALQAISEGVGTSLLSTLSSPGPKLDNSPNMNISQPSKVSGQDSKSPLGLYCEQNPVESSVCQSNSRDPQVKKESKESSGEVSETPRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDPNCKDSSVSVTSPSGVSSSTSGTVSSTSNVHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSTASCGEGTTRQEQLSPKKKENNALLRYLLDRDDPSDVLAKELQPQADSGDSKLSQCSCSTNPSSGQEKDPKIKTETNDEVSGDLDNLDAILGDLTSSDFYNNPTNGGHPGAKQQMFAGPSSLGLRSPQPVQSVRPPYNRAVSLDSPVSVGSGPPVKNVSAFPGLPKQPILAGNPRMMDSQENYGANMGPNRNVPVNPTSSPGDWGLANSRASRMEPLASSPLGRTGADYSATLPRPAMGGSVPTLPLRSNRLPGARPSLQQQQQQQQQQQQQQQQQQQQQQQMLQMRTGEIPMGMGVNPYSPAVQSNQPGSWPEGMLSMEQGPHGSQNRPLLRNSLDDLLGPPSNAEGQSDERALLDQLHTFLSNTDATGLEEIDRALGIPELVNQGQALESKQDVFQGQEAAVMMDQKAALYGQTYPAQGPPLQGGFNLQGQSPSFNSMMGQISQQGSFPLQGMHPRAGLVRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALEMKMENPAGTAVMRPMMPQAFFNAQMAAQQKRELMSHHLQQQRMAMMMSQPQPQAFSPPPNVTASPSMDGVLAGSAMPQAPPQQFPYPANYGMGQPPEPAFGRGSSPPSAMMSSRMGPSQNAMVQHPQPTPMYQPSDMKGWPSGNLARNGSFPQQQFAPQGNPAAYNMVHMNSSGGHLGQMAMTPMPMSGMPMGPDQKYC pias1_mouse E3 SUMO-protein ligase PIAS1 Pias1 Ddxbp1 DEAD/H box-binding protein 1 Protein inhibitor of activated STAT protein 1 RING-type E3 ubiquitin transferase PIAS1 protein protein mouse Mus musculus Mouse MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKELYRRRFPQKIMTPADLSIPNVHSSPMPPTLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNGVEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRTYSMAVYLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGSWAPMRSKKEVQEVTASYNGVDGCLSSTLEHQVASHNQSSNKNKKVEVIDLTIDSSSDEEEEEPPAKRTCPSLSPTSPLSNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTSLPATNGSSSGSNSSLVSSNSLRESHGHGVASRSSADTASIFGIIPDIISLD sap18_mouse Histone deacetylase complex subunit SAP18 Sap18 18 kDa Sin3-associated polypeptide Sin3-associated polypeptide p18 protein protein mouse Mus musculus Mouse MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFMDLKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPSSGRMRPY gli3_human Transcriptional activator GLI3 GLI3 GLI3 full-length protein GLI3 form of 190 kDa protein protein human Homo sapiens Human MEAQSHSSTTTEKKKVENSIVKCSTRTDVSEKAVASSTTSNEDESPGQTYHRERRNAITMQPQNVQGLSKVSEEPSTSSDERASLIKKEIHGSLPHVAEPSVPYRGTVFAMDPRNGYMEPHYHPPHLFPAFHPPVPIDARHHEGRYHYDPSPIPPLHMTSALSSSPTYPDLPFIRISPHRNPTAASESPFSPPHPYINPYMDYIRSLHSSPSLSMISATRGLSPTDAPHAGVSPAEYYHQMALLTGQRSPYADIIPSAATAGTGAIHMEYLHAMDSTRFSSPRLSARPSRKRTLSISPLSDHSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSASAISPALSFTYSSAPVSLHMHQQILSRQQSLGSAFGHSPPLIHPAPTFPTQRPIPGIPTVLNPVQVSSGPSESSQNKPTSESAVSSTGDPMHNKRSKIKPDEDLPSPGARGQQEQPEGTTLVKEEGDKDESKQEPEVIYETNCHWEGCAREFDTQEQLVHHINNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCTKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDIHPRPPPPRDSGSHSQSRSPGRPTQGALGEQQDLSNTTSKREECLQVKTVKAEKPMTSQPSPGGQSSCSSQQSPISNYSNSGLELPLTDGGSIGDLSAIDETPIMDSTISTATTALALQARRNPAGTKWMEHVKLERLKQVNGMFPRLNPILPPKAPAVSPLIGNGTQSNNTCSLGGPMTLLPGRSDLSGVDVTMLNMLNRRDSSASTISSAYLSSRRSSGISPCFSSRRSSEASQAEGRPQNVSVADSYDPISTDASRRSSEASQSDGLPSLLSLTPAQQYRLKAKYAAATGGPPPTPLPNMERMSLKTRLALLGDALEPGVALPPVHAPRRCSDGGAHGYGRRHLQPHDAPGHGVRRASDPVRTGSEGLALPRVPRFSSLSSCNPPAMATSAEKRSLVLQNYTRPEGGQSRNFHSSPCPPSITENVTLESLTMDADANLNDEDFLPDDVVQYLNSQNQAGYEQHFPSALPDDSKVPHGPGDFDAPGLPDSHAGQQFHALEQPCPEGSKTDLPIQWNEVSSGSADLSSSKLKCGPRPAVPQTRAFGFCNGMVVHPQNPLRSGPAGGYQTLGENSNPYGGPEHLMLHNSPGSGTSGNAFHEQPCKAPQYGNCLNRQPVAPGALDGACGAGIQASKLKSTPMQGSGGQLNFGLPVAPNESAGSMVNGMQNQDPVGQGYLAHQLLGDSMQHPGAGRPGQQMLGQISATSHINIYQGPESCLPGAHGMGSQPSSLAVVRGYQPCASFGGSRRQAMPRDSLALQSGQLSDTSQTCRVNGIKMEMKGQPHPLCSNLQNYSGQFYDQTVGFSQQDTKAGSFSISDASCLLQGTSAKNSELLSPGANQVTSTVDSLDSHDLEGVQIDFDAIIDDGDHSSLMSGALSPSIIQNLSHSSSRLTTPRASLPFPALSMSTTNMAIGDMSSLLTSLAEESKFLAVMQ zn219_mouse Zinc finger protein 219 Znf219 Zfp219 protein protein mouse Mus musculus Mouse MEGSRPRILVGHLEPSPPAFDGELDLQRYSNGPGVSGTPGPGSPGMGAVGWSETRAGERRFPCPVCGKRFRFNSILALHLRAHPGAQAFQCPHCGHRAAQRALLRSHLRTHQPERPRSPAARLLLELEERALLREARLGRARSSGGMQSSPAAEGLARPQVPSSSAFRCPFCKGKFRTSAERERHLHILHRPWKCSLCSFGSSQEEELLHHSLTAHGASERPLAATSTPEPPPPPQQEPRSALEPEPEPEPRPEPDREANPAPTPAPPEEPPAPPEFRCQVCGQSFTQSWFLKGHMRKHKASFDHACPVCGRCFKEPWFLKNHMKVHTSKLGPLRAPGPGSAPARAPQPPDLSLLAYEPLGPALLLAPAPAPAERREPPSLLGYLSVRAGEVRPNGEGADPGGGRSYGGFRPLPSALPNRARRHRTEEPEEEEEVVEAEEESWARGRSLGSLTSLHPNPGEGSGQPAPAAGTQARSTATQEENGLLVGGTRSEAGRGATGKDCPFCGKSFRSAHHLKVHLRVHTGERPYKCPHCDYAGTQSGSLKYHLQRHHREQRSSAGPGPPPEPPPPSQRGSLQPQSGAKPTQASATWVEGTASTRPPSSSTGPGSRRKPASPGRTLRNGRGGEAEPLDLSLRAGPGGEAGAGGALHRCLFCPFATGAPELMALHLQVHHSRRARGRRQPRADTSPTYVRAPSGETPPSPPLEEEGSPGLSRSGEAGLGGQER rn19a_mouse E3 ubiquitin-protein ligase RNF19A Rnf19a Geg-154 Rnf19 Xybp Double ring-finger protein Gametogenesis-expressed protein GEG-154 RING finger protein 19A UBCM4-interacting protein 117 XY body protein protein protein mouse Mus musculus Mouse MQEQEISFIFKYNEGLCMNIDSDSILMSILDMSLHQQMGSDRDLQSSTSSVSLPSVKKAPKQRRISIGSLFRRKKDSKRKSRELNGGVDGIASIESIHSEMCADKNSIFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVDCLRQYLRIEISESRVNISCPECTERFNPHDIRLILSDDVLMEKYEEFMLRRWLVADPDCRWCPAPDCGYAVIAFGCASCPKLTCGREGCGTEFCYHCKQIWHPNQTCDAARQERAQSLRLRTIRSSSISYSQESGAAADDIKPCPRCAAYIIKMNDGSCNHMTCAVCGCEFCWLCMKEISDLHYLSPSGCTFWGKKPWSRKKKILWQLGTLVGAPVGIALIAGIAIPAMIIGIPVYVGRKIHNRYEGKDVSKHKRNLAIAGGVTLSVIVSPVVAAVTVGIGVPIMLAYVYGVVPISLCRSGGCGVSAGNGKGVRIEFDDENDINVGGTNAAIDTTSVAEARHNPSIGEGSVGGLTGSLSASGSHMDRIGTIRDNLSETASTMALAGASITGSLSGSAMVNCFNRLEVQADVQKERCSLSGESGTVSLGTVSDNASTKAMAGSILNSYIPLDREGNSMEVQVDIESKPFKFRHNSGSSSVDDSGATRGHTGGASSGLPEGKSSATKWSKEATGGKKSKSGKLRKKGNMKINETREDMDAQLLEQQSTNSSEFEAPSLSDSMPSVADSHSSHFSEFSCSDLESMRTSCSHGSSDCHARFTAVNTLPEVENDRLENSPHQCSSALLSKAASCSDVPQPSHAADEHGTSRSGGKPMVDLCFGDALRETNNNHSHQTADLKVAVQTEI roa1_mouse Heterogeneous nuclear ribonucleoprotein A1 Hnrpa1 hnRNP core protein A1 Helix-destabilizing protein HDP-1 Single-strand-binding protein Topoisomerase-inhibitor suppressed Hnrnpa1 Fli-2 Tis protein protein mouse Mus musculus Mouse MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF setb1_mouse Histone-lysine N-methyltransferase SETDB1 Setdb1 Eset Kiaa0067 SET domain bifurcated 1 ERG-associated protein with SET domain protein protein mouse Mus musculus Mouse MSSLPGCMSLAAAPAAADSAEIAELQQAVVEELGISMEELRQYIDEELEKMDCIQQRKKQLAELETWVLQKESEVAYVDRLFDDASREVTNCESLVKDFYSKLGLQYHDSSSEDEASRPTEIIEIPDEDDDVLSIDSGDAGSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSSSQDLHKGTLGQVSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGLGKKYKVKFDNKGKSLLSGNHIAYDYHPPADKLFVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDGYASYVTQSELYPICRPLKKTWEDIEDSSCRDFIEEYITAYPNRPMVLLKSGQLIKTEWEGTWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASAMEKKQGGQLRTRPNMGAVRSKGPVVQYTQDLTGTGIQFKPMEPLQPIAPPAPLPIPPLSPQAADTDLESQLAQSRKQVAKKSTSFRPGSVGSGHSSPTSSTLSENVSAGKLGINQTYRSPLASVTSTPASAAPPVPPVPPGPPTPPGPPAPPGPLAPPAFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRIRPMRNEQYRGKNPLLVPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLFETGCDFLFLEMFCLDPYVLVDRKFQPFKPFYYILDITYGKEDVPLSCVNEIDTTPPPQVAYSKERIPGKGVFINTGPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQVNPNSGYQYKRLEECLPTGVYECNKRCNCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESDVPTSSDSSGVDMKDQEDGNSGSEDPEESNDDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKENELSEMTSKDSRPPDLGPPHVPIPSSVSVGGCNPPSSEETPKNKVASWLSCNSVSEGGFADSDSRSSFKTSEGGDGRAGGGRGEAERASTSGLSFKDEGDNKQPKKEDPENRNKMPVVTEGSQNHGHNPPMKSEGLRRPASKMSVLQSQRVVTSTQSNPDDILTLSSSTESEGESGTSRKPTAGHTSATAVDSDDIQTISSGSDGDDFEDKKNLSGPTKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGESAPVRKNTRQFYDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNYEVGSVEGKELLCCCGAIECRGRLL hmga1_mouse High mobility group protein HMG-I/HMG-Y High mobility group AT-hook protein 1 Hmga1 Hmgi Hmgiy protein protein mouse Mus musculus Mouse MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKVTTAPGRKPRGRPKKLEKEEEEGISQESSEEEQ cebpz_mouse CCAAT/enhancer-binding protein zeta Cebpz Cbf2 Cebpa-rs1 CCAAT-box-binding transcription factor protein protein mouse Mus musculus Mouse MSADQEPVAFLAKQPWRPKQVTEDPDEEDEEDGDEGKNGFSLEEVLRLGGTKQDYLMLATLDENEEVVDGGKKGTIDDLQQGELESFIQNLNLAKYSKSLIEEDEPEKKENASKKEAKLLKVENKKQKATEGKKTSEKKVKNKTVAEQRPESCPVSKAKKDKQPDVFEFLERQTMLLRPGGKWYDMEYSGEYSLEPQPPDVVSKYKALAQKLYEHEVSLFKSKTNNQKGGSSTWMKAIVSSGTLADRMAAMILLIQDDAVHTLQFVETLMSLVKKKGSKQQCLMALDTFKELLITDLLPDSRKLRVFSQHPFHKLEEMSSGNKDSRDRRLILWYYEHQLKHLVAEFVQVLETLSHDSLVTTKTRALVAAHELLCDKPEEEKALLVQVINKLGDPQNRIATKASHLLEVLLRKHPNMKGVVCGEIERLLFRSNISPKAQYYAICFLNQMVLSHEESELANKLITLYFCFFRTCIKKKDIESKMLSAILTGVNRAYPYSQIGDDKVREQVDTLFKVLHVVNFNTSVQALMLLFQVMNSQQTISDRYYTALYRKMLDPGLTTCSKQAMFLNLIYKSLKADIMLRRVKAFVKRLLQVTCTQMPPFICGALYLVSEILKAKPDLRSQLDDHPESDEENFVDVGDDSDDEKFTDADKGTATDAVKEVESKETEPESSAEAEKPKAASWVHFDNLKGGKQIKTYDPFSRNPLFCGAENTTLWELKKLSEHFHPSVALFAKTILEGNCIQYSGDPLQDFTLMRFLDRFVYRNPKLHKGKENTDSVVMQPKRKHFMKNVRDLAVNSKEFLAKEESQIPVDEVFFYRYYKKVAVVKDKQKRSADEESIEDIDDEEFENMIDTFEDDNCFPPGKDDIDFASNMKKTKGAKADLEDSESSDGELGDLDDDEVSLGSMNDEDFEIDEDGGTFMDVSDDESEDAPEFADANPKANTKKSKRKSEDDFDFAGSFQGQKKKKKSFNDSSLFVSAEEFGHLLDENMGSKFDTIGMNAMANRDNASFKQLKWEAERDDWLHNRDVKSIIKKKKNFRKKMKAPQKPKRQRK prdx6_mouse Peroxiredoxin-6 Lysophosphatidylcholine acyltransferase 5 Glutathione-dependent peroxiredoxin Antioxidant protein 2 1-Cys peroxiredoxin Acidic calcium-independent phospholipase A2 Non-selenium glutathione peroxidase Prdx6 Aop2 Ltw4 Prdx5 protein protein mouse Mus musculus Mouse MPGGLLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSKDINAYNGETPTEKLPFPIIDDKGRDLAILLGMLDPVEKDDNNMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTGTKPVATPVDWKKGESVMVVPTLSEEEAKQCFPKGVFTKELPSGKKYLRYTPQP ltor3_mouse Ragulator complex protein LAMTOR3 Map2k1ip1 Mitogen-activated protein kinase kinase 1-interacting protein 1 Lamtor3 Mapbp MEK-binding partner 1 Mapksp1 Late endosomal/lysosomal adaptor and MAPK and MTOR activator 3 Mitogen-activated protein kinase scaffold protein 1 protein protein mouse Mus musculus Mouse MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDSAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELIKVVEVS sap18_drome Histone deacetylase complex subunit SAP18 Bin1 SAP18 CG6046 18 kDa Sin3-associated polypeptide Bicoid-interacting protein 1 dSAP18 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MANVESMIVEEKTQVKQIDREKTCPMLLRVFCSTGRHHSVSEYMFGNVPTNELQIYTWQDATLHELTSLVRDVNPDTRKKGTYFDFAVVYPNFRSNHFQMREIGVTCTGQKGIDDNKTLAQAKFSIGDFLDISITPPNRLPPTARRQRPY h2ay_mouse Core histone macro-H2A.1 Macroh2a1 H2A.y H2A/y H2afy protein protein mouse Mus musculus Mouse MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGSKGKLEAIITPPPAKKAKSPSQKKPVAKKTGGKKGARKSKKKQGEVSKAASADSTTEGTPTDGFTVLSTKSLFLGQKLNLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAISAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLALADDRKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFMLFDSESIGIYVQEMAKLDAN sufu-ci 1016014 n/a 1016020 unspecified role unspecified role prey prey n/a 1016021 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false sufu-gli1 1016014 n/a 1016022 unspecified role unspecified role prey prey n/a 1016021 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 4 sufu-leg3 1016014 n/a 1016023 unspecified role unspecified role prey prey n/a 1016021 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 4 su_fu_-ci-3 1016014 n/a 1016024 unspecified role unspecified role bait bait n/a 1016020 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 cos-fu-3 1016014 n/a 1016025 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1016026 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 ncoa3-fu 1016014 n/a 1016026 unspecified role unspecified role prey prey n/a 1016027 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 pias1-bin1-1 1016014 n/a 1016021 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1016028 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 sap18-h2ay 1016014 n/a 1016028 unspecified role unspecified role prey prey n/a 1016029 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 sufu-gli3 1016014 n/a 1016030 unspecified role unspecified role prey prey n/a 1016021 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 4 cos-q924s6 1016014 n/a 1016031 unspecified role unspecified role prey prey n/a 1016025 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 4 cos-pias1 1016014 n/a 1016028 unspecified role unspecified role prey prey n/a 1016025 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false ci-g9vg38 1016014 n/a 1016024 unspecified role unspecified role prey prey n/a 1016020 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 fu-ci-1 1016014 n/a 1016026 unspecified role unspecified role bait bait n/a 1016020 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 fu-ci 1016014 n/a 1016026 unspecified role unspecified role bait bait n/a 1016024 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 leg3-leg3 1016014 n/a 1016023 unspecified role unspecified role prey prey n/a 1016023 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 rn19a-sufu 1016014 n/a 1016021 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1016032 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 leg3-sufu-1 1016014 n/a 1016023 unspecified role unspecified role bait bait n/a 1016021 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 4 zfp219-zfp219 1016014 n/a 1016031 unspecified role unspecified role prey prey n/a 1016031 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 sufu-sufu-2 1016014 n/a 1016021 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1016021 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 4 sufu-ncoa3 1016014 n/a 1016027 unspecified role unspecified role prey prey n/a 1016021 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false sufu-sap18-1 1016014 n/a 1016033 unspecified role unspecified role prey prey n/a 1016021 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false sufu-setdb1 1016014 n/a 1016021 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1016034 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 sufu-rn19a 1016014 n/a 1016032 unspecified role unspecified role prey prey n/a 1016021 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 4 sufu-sap18-1 1016014 n/a 1016021 unspecified role unspecified role bait bait n/a 1016029 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 4 sufu-hmga1 1016014 n/a 1016021 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 1016035 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 sufu-cebpz 1016014 n/a 1016036 unspecified role unspecified role prey prey n/a 1016021 unspecified role unspecified role bait bait physical association physical association false false false sufu-prdx6-1 1016014 n/a 1016021 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 1016037 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 sufu-mapksp1-1 1016014 n/a 1016038 unspecified role unspecified role prey prey n/a 1016021 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 4 sufu-pias1-1 1016014 n/a 1016028 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 1016021 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 sufu-fu 1016014 n/a 1016026 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 1016021 unspecified role unspecified role bait bait physical association physical association false false false sufu-bin1-1 1016014 n/a 1016021 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 1016039 unspecified role unspecified role prey prey physical association physical association false false false su_fu_-gli1 1016014 n/a 1016022 unspecified role unspecified role prey prey n/a 1016024 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 su_fu_-pias1 1016014 n/a 1016024 unspecified role unspecified role bait bait n/a 1016028 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 su_fu_-fu-1 1016014 n/a 1016024 unspecified role unspecified role bait bait n/a 1016026 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 ncoa3-gli1 1016014 n/a 1016022 unspecified role unspecified role prey prey n/a 1016027 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 ncoa3-1 1016014 n/a 1016027 unspecified role unspecified role bait bait n/a 1016027 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 ncoa3-roa1 1016014 n/a 1016033 unspecified role unspecified role prey prey n/a 1016027 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 ncoa3-rnf19a 1016014 n/a 1016032 unspecified role unspecified role prey prey n/a 1016027 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 ncoa3-setb1 1016014 n/a 1016034 unspecified role unspecified role prey prey n/a 1016027 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 ncoa3-znf219 1016014 n/a 1016027 unspecified role unspecified role bait bait n/a 1016031 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 ncoa3-leg3 1016014 n/a 1016023 unspecified role unspecified role prey prey n/a 1016027 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 ncoa3-sap18 1016014 n/a 1016027 unspecified role unspecified role bait bait n/a 1016029 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 ncoa3-prdx6 1016014 n/a 1016037 unspecified role unspecified role prey prey n/a 1016027 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 ncoa3-mp1 1016014 n/a 1016038 unspecified role unspecified role prey prey n/a 1016027 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 ncoa3-pias1 1016014 n/a 1016028 unspecified role unspecified role prey prey n/a 1016027 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 rn19a-pias1-1 1016014 n/a 1016032 unspecified role unspecified role bait bait n/a 1016028 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 sap18-sufu 1016014 n/a 1016021 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1016029 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 sap18-hmga1 1016014 n/a 1016035 unspecified role unspecified role prey prey n/a 1016029 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 pias1-gli1 1016014 n/a 1016028 unspecified role unspecified role bait bait n/a 1016022 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 pias1-gli3 1016014 n/a 1016030 unspecified role unspecified role prey prey n/a 1016028 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 pias1-ncoa3 1016014 n/a 1016028 unspecified role unspecified role bait bait n/a 1016027 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 pias1-hnrnpa1 1016014 n/a 1016033 unspecified role unspecified role prey prey n/a 1016028 unspecified role unspecified role bait bait physical association physical association false false false pias1-setdb1 1016014 n/a 1016034 unspecified role unspecified role prey prey n/a 1016028 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 pias1-q924s6 1016014 n/a 1016031 unspecified role unspecified role prey prey n/a 1016028 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 pias1-leg3 1016014 n/a 1016023 unspecified role unspecified role prey prey n/a 1016028 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 pias1-sap18 1016014 n/a 1016029 unspecified role unspecified role prey prey n/a 1016028 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 pias1-mapksp1 1016014 n/a 1016038 unspecified role unspecified role prey prey n/a 1016028 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 pias1-ci 1016014 n/a 1016020 unspecified role unspecified role prey prey n/a 1016028 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 pias1-bin1-2 1016014 n/a 1016039 unspecified role unspecified role prey prey n/a 1016028 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 pias1-su_fu_ 1016014 n/a 1016028 unspecified role unspecified role bait bait n/a 1016024 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 sufu-cebpz-1 1016015 n/a 1016021 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1016036 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1. sufu-leg3-1 1016015 n/a 1016023 unspecified role unspecified role prey prey n/a 1016021 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1. sufu-sap18-3 1016015 n/a 1016021 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1016029 unspecified role unspecified role prey prey physical association physical association false false false Table 1. sufu-ncoa3-1 1016015 n/a 1016021 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1016027 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1. sufu-hnrnpa1 1016015 n/a 1016033 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1016021 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1. sufu-rn19a-1 1016015 n/a 1016032 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1016021 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1. sufu-setdb1-1 1016015 n/a 1016034 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1016021 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1. sufu-q924s6 1016015 n/a 1016021 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1016031 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1. sufu-pias1 1016015 n/a 1016021 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1016028 unspecified role unspecified role prey prey physical association physical association false false false Table 1. sufu-h2ay 1016015 n/a 1016021 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1016040 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1. sufu-hmga1-1 1016015 n/a 1016035 unspecified role unspecified role prey prey n/a 1016021 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1. sufu-prdx6 1016015 n/a 1016037 unspecified role unspecified role prey prey n/a 1016021 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1. sufu-mapksp1 1016015 n/a 1016021 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1016038 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1. leg3-sufu 1016016 n/a 1016023 unspecified role unspecified role neutral component neutral component his6/xpress tagged tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1016021 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Upon co-transfection, nuclear leg3 level decreased and proteins accumulated in cytoplasm where it colocalized with sufu in 61% of double-labelled cells. LMB treatment blocks the effect of sufu on the cytoplasmic localization of leg3. Fig. 6H sap18-sufu-2 1016016 n/a 1016029 unspecified role unspecified role neutral component neutral component his6/xpress tagged tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1016021 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Upon co-transfection, sufu translocated to the nucleus and colocalized with sap18 in 67% of cells. Fig. 6J sap18-sufu-1 1016017 n/a 1016021 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1016029 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 5A sufu-leg3 1016018 n/a 1016021 unspecified role unspecified role bait bait tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1016023 unspecified role unspecified role prey prey tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 5B sufu-sap18-2 1016019 n/a 1016021 unspecified role unspecified role bait bait tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1016029 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false association association false false false Fig. 5A