MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint kloeker-2003-1 Parallel purification of three catalytic subunits of the protein serine/threonine phosphatase 2A family (PP2A(C), PP4(C), and PP6(C)) and analysis of the interaction of PP2A(C) with alpha4 protein. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Kloeker S., Reed R., McConnell JL., Chang D., Tran K., Westphal RS., Law BK., Colbran RJ., Kamoun M., Campbell KS., Wadzinski BE. Protein Expr. Purif. (1046-5928) 2003 partial coverage rapid curation kloeker-2003-2 Parallel purification of three catalytic subunits of the protein serine/threonine phosphatase 2A family (PP2A(C), PP4(C), and PP6(C)) and analysis of the interaction of PP2A(C) with alpha4 protein. chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Kloeker S., Reed R., McConnell JL., Chang D., Tran K., Westphal RS., Law BK., Colbran RJ., Kamoun M., Campbell KS., Wadzinski BE. Protein Expr. Purif. (1046-5928) 2003 partial coverage rapid curation kloeker-2003-3 Parallel purification of three catalytic subunits of the protein serine/threonine phosphatase 2A family (PP2A(C), PP4(C), and PP6(C)) and analysis of the interaction of PP2A(C) with alpha4 protein. in vitro In vitro competition binding competition binding predetermined predetermined participant predetermined Kloeker S., Reed R., McConnell JL., Chang D., Tran K., Westphal RS., Law BK., Colbran RJ., Kamoun M., Campbell KS., Wadzinski BE. Protein Expr. Purif. (1046-5928) 2003 partial coverage rapid curation igbp1_mouse Immunoglobulin-binding protein 1 Igbp1 Pc52 Protein phosphatase 2/4/6 regulatory subunit CD79a-binding protein 1 Alpha4 phosphoprotein Lymphocyte signal transduction molecule alpha 4 p52 protein protein mouse Mus musculus Mouse MAASEDELLLPRLPELFETSKKLLEDVEVATEPTGSRTIQDKVSKGLELLEKAAGMLSQLDLFSRNEDLEEIASTDLKYLMVPALQGALTMKQVNPSKRLDHLQRAREHFVHFLTQCHCYHVAEFQLPQTKTNSAENNTASSSMAYPNLVAMASQRQAKIERYKQKKEVEHRLSALKSAVESGQADDERVREYHLLHLRRWIAVSLEELESIDQEIKILKEKDSPREETACHSSLPEKPPMKPFILTRNKAQAKVFGTGYPSLATMTVSDWYEQHQKYGVLPDRGIAKPASADFQRAAQQQEDQEQKDEESEEKALHRMREWDDWKDTHPRGYGNRQNMG mint homomint Associated to surface IgM-receptor; may be involved in signal transduction. May be involved in regulation of the catalytic activity of type 2A-related serine/threonine phosphatases pp2aa_human Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform PPP2CA Replication protein C protein protein human Homo sapiens Human MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL igbp1-ppp2ca-3 1186964 igbp1_mouse 1186967 unspecified role unspecified role bait bait pp2aa_human 1186968 unspecified role unspecified role prey prey physical association physical association false false false homomint mint F5B igbp1-ppp2ca-4 1186965 igbp1_mouse 1186967 unspecified role unspecified role bait bait pp2aa_human 1186968 unspecified role unspecified role prey prey physical association physical association false false false homomint mint F5A F6 igbp1-ppp2ca-5 1186966 igbp1_mouse 1186967 unspecified role unspecified role bait bait pp2aa_human 1186968 unspecified role unspecified role prey prey direct interaction direct interaction false false false F7 homomint mint