UniProt UniProt http://www.uniprot.org short-2001-2 Golgi matrix proteins interact with p24 cargo receptors and aid their efficient retention in the Golgi apparatus. rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Short B., Preisinger C., Korner R., Kopajtich R., Byron O., Barr F.A. Used cytoplasmic tail constructs of following p24 proteins have been mapped to rat origin as mammalian sequences are identical and interacting partners are of rat origin: TMP21/p24delta1/TMED1, p24a/p24beta1/TMED2, gp25L/p24alpha2TMED9 and gp27/p24gamma3/TMED7. Experiments using the cytoplasmic tail of the following proteins are omitted as their origin could not be established from the publication and mammalian proteins are differing in the respective region: p24b/p24gamma4/TMED3, ST2/TMED1/p24gamma1 and p24b/TMED3/p24gamma4; TGF-alpha and GM130 (C-terminus). Range of p24 cytoplasmic tails according UniProt. barr@biochem.mpg.de J. Cell Biol. (0021-9525) 2001 Only protein-protein interactions imex curation short-2001-4 Golgi matrix proteins interact with p24 cargo receptors and aid their efficient retention in the Golgi apparatus. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Short B., Preisinger C., Korner R., Kopajtich R., Byron O., Barr F.A. Used cytoplasmic tail constructs of following p24 proteins have been mapped to rat origin as mammalian sequences are identical and interacting partners are of rat origin: TMP21/p24delta1/TMED1, p24a/p24beta1/TMED2, gp25L/p24alpha2TMED9 and gp27/p24gamma3/TMED7. Experiments using the cytoplasmic tail of the following proteins are omitted as their origin could not be established from the publication and mammalian proteins are differing in the respective region: p24b/p24gamma4/TMED3, ST2/TMED1/p24gamma1 and p24b/TMED3/p24gamma4; TGF-alpha and GM130 (C-terminus). Range of p24 cytoplasmic tails according UniProt. barr@biochem.mpg.de J. Cell Biol. (0021-9525) 2001 Only protein-protein interactions imex curation short-2001-3 Golgi matrix proteins interact with p24 cargo receptors and aid their efficient retention in the Golgi apparatus. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Short B., Preisinger C., Korner R., Kopajtich R., Byron O., Barr F.A. Used cytoplasmic tail constructs of following p24 proteins have been mapped to rat origin as mammalian sequences are identical and interacting partners are of rat origin: TMP21/p24delta1/TMED1, p24a/p24beta1/TMED2, gp25L/p24alpha2TMED9 and gp27/p24gamma3/TMED7. Experiments using the cytoplasmic tail of the following proteins are omitted as their origin could not be established from the publication and mammalian proteins are differing in the respective region: p24b/p24gamma4/TMED3, ST2/TMED1/p24gamma1 and p24b/TMED3/p24gamma4; TGF-alpha and GM130 (C-terminus). Range of p24 cytoplasmic tails according UniProt. barr@biochem.mpg.de J. Cell Biol. (0021-9525) 2001 Only protein-protein interactions imex curation short-2001-1 Golgi matrix proteins interact with p24 cargo receptors and aid their efficient retention in the Golgi apparatus. rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Short B., Preisinger C., Korner R., Kopajtich R., Byron O., Barr F.A. Used cytoplasmic tail constructs of following p24 proteins have been mapped to rat origin as mammalian sequences are identical and interacting partners are of rat origin: TMP21/p24delta1/TMED1, p24a/p24beta1/TMED2, gp25L/p24alpha2TMED9 and gp27/p24gamma3/TMED7. Experiments using the cytoplasmic tail of the following proteins are omitted as their origin could not be established from the publication and mammalian proteins are differing in the respective region: p24b/p24gamma4/TMED3, ST2/TMED1/p24gamma1 and p24b/TMED3/p24gamma4; TGF-alpha and GM130 (C-terminus). Range of p24 cytoplasmic tails according UniProt. barr@biochem.mpg.de J. Cell Biol. (0021-9525) 2001 Only protein-protein interactions imex curation short-2001-5 Golgi matrix proteins interact with p24 cargo receptors and aid their efficient retention in the Golgi apparatus. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Short B., Preisinger C., Korner R., Kopajtich R., Byron O., Barr F.A. Used cytoplasmic tail constructs of following p24 proteins have been mapped to rat origin as mammalian sequences are identical and interacting partners are of rat origin: TMP21/p24delta1/TMED1, p24a/p24beta1/TMED2, gp25L/p24alpha2TMED9 and gp27/p24gamma3/TMED7. Experiments using the cytoplasmic tail of the following proteins are omitted as their origin could not be established from the publication and mammalian proteins are differing in the respective region: p24b/p24gamma4/TMED3, ST2/TMED1/p24gamma1 and p24b/TMED3/p24gamma4; TGF-alpha and GM130 (C-terminus). Range of p24 cytoplasmic tails according UniProt. barr@biochem.mpg.de J. Cell Biol. (0021-9525) 2001 Only protein-protein interactions imex curation tmed2_rat Transmembrane emp24 domain-containing protein 2 RNP21.4 Tmed2 Rnp24 Membrane protein p24A p24 family protein beta-1 COPI-coated vesicle membrane protein p24 protein protein rat Rattus norvegicus (Rat) Rat MVTLAELLVLLAALLATASGYFVSIDAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVEITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQDMETEAHQNKLEEMINELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVLVAMTLGQIYYLKRFFEVRRVV gors2_rat Golgi reassembly-stacking protein 2 Gorasp2 Golgi reassembly-stacking protein of 55 kDa protein protein rat Rattus norvegicus (Rat) Rat MGSSQSVEIPGGGTEGYHVLRVQENSPGHRAGLEPFFDFIVSISGSRLNKDNDTLKDLLKANVEKPVKMLIYSSKTLELREASVTPSNLWGGQGLLGVSIRFCSFDGANENVWHVLEVESNSPAALAGLRPHSDYIIGADTVMNESEDLFSLIETHEAKPLKLYVYNTDTDNCREVIITPNSAWGGEGSLGCGIGYGYLHRIPTRPFEEGKKISLPGQMTGTPITPLKDGFTQVQLSSVSPPSLSPPGTAGVEQSLSGLSISSAPPAVSNVLSTGVPTVPLLPPQVNQSLASVPPMNPAATLPSLMPLSAGLPNLPNLPSLSNFNLPAPHIMPGVGLPELGKPGLPPLPSLPPRNVPGIAPLPMPSDFLPSFPLVPEGSSAASAGEPLSSLPAMGPPSDPVMTTAKADTSSLTVDVMSPASKVPTTVEDRVSDCTPAMEKPVSAVTDANASGAS tmed9_rat Transmembrane emp24 domain-containing protein 9 Tmed9 p24 family protein alpha-2 protein protein rat Rattus norvegicus (Rat) Rat MAAVRGVRVVGTSPGLLLGRGMRAFLLLLCLAARGGALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQMRHLKSFFEAKKLV gors1_rat Golgi reassembly-stacking protein 1 Gorasp1 Grasp65 Golgi peripheral membrane protein p65 Golgi reassembly-stacking protein of 65 kDa protein protein rat Rattus norvegicus (Rat) Rat MGLGASSEQPAGGEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMKTMRVREVEVVPSNMWGGQGLLGASVRFCSFRRASEHVWHVLDVEPSSPAALAGLRPYTDYIVGSDQILQESEDFFTLIESHEGKPLKLMVYNSESDSCREVTVTPNAAWGGEGSLGCGIGYGYLHRIPTQPSSQYKKPPSASSPGTPAKTPQPNAFPLGAPPPWPIPQDSSGPELGSRQSDYMEALPQVPGGFMEEQLPGPGSPGHGTADYGGCLHSMEIPLQPPPPVQRVMDPGFLDVSGMSLLDSNNTSVCPSLSSSSLLTPTAVSALGPEDIGSSSSSHERGGEATWSGSEFEISFPDSPGSQAQVDHLPRLTLPDGLTSAASPEEGLSAELLEAQTEEPAHTASLDCMAQTEGPAGQVQAAPDPEPGLCEGPW goga2_rat Golgin subfamily A member 2 Golga2 130 kDa cis-Golgi matrix protein protein protein rat Rattus norvegicus (Rat) Rat MWPPRFPPPRPGMSEETRQSKLAAAKKKLREYQQKNSPGVPAGAKKKKKIKNGHSPERTSASDCQSAENVPTDHTAPAPPSTAAATMFLGVVPSPDADLIQSHDAGNCSNLMEETKTFSSTESLRQLSQQLNGLVSESTSYINGEGLTSSNMKELESRYQELAVALDSSYVTNKQLSSTIEELKQQNQDTLDQLEKEKKDYQQKLAKEQGALREQLQVHIQTIGILVSEKAELQTALAHTQQAARQKAGESEDLASRLQSSRQRVGELERTLSTVSTQQKQADRYNKDLTKERDALKLELYKNGKSNEDLRQQNSELEEKLRVLVAEKAAAQLGAEELQKKLEMSELLLQQFSSQSEASGSNEQLQQAMEERAQLESHVGQLMESLKQLQVERDQYAENLKGESAMWQQRVQQMAEQVHALKEEKEQRESQVQELEASLAELRSQMEEPPPPEPPTGPSEAEERLQGEVEQLQKELEGLTGQLRAQVQDNESLSHLNREQEGRLLELEREAQHWSEQAEERKQILESMQSDRTTISRALSQNRELKEQLAELQNGFVRLTNENMEITSALQSEQHVKKELARKLGELQERLGELKETVELKSQEAQGLQEQRDQCLSHLQQYAAAYQQHLTAYEQLTSEKEALHKQLLLQTQLMDQLQHEEVQGKMAAEMARQELQEAQERLKASSQENQQLQAQLSLLVLPGEDMDQEEQDEEVPQPSLTIPEDLVSREAMVAFCNAAIARAEEEQARLRVQLREQKARCRSLAHLAAPVQSKLEKEAVVPRDMGDSVSEESNQALHVAMEKLQNRFLEVMQEKVELKERVEELEHCCIQLSGETDTIGEYIALYQNQRAVLKARHLEKEEYISRLAQDKEEMKVKLLELQELVLRLVNERNEWQGKFLAVSQNPADVPAPVPTGSQEFGAADQQGDLREVSLADDTEPAQGEAGVPAPQENPTAQQIMQLLREIQNPQERPGLGSNPCIPFFYRADENDEVKIMVI tmeda_rat Transmembrane emp24 domain-containing protein 10 21 kDa transmembrane-trafficking protein Transmembrane protein Tmp21 Tmed10 Tmp21 p24 family protein delta-1 protein protein rat Rattus norvegicus (Rat) Rat MSGLSGPLSWPGPLLSALLFLFLLGPSSVLGISFHLPVNSRKCLREEIHKDLLVTGAYEITDQSGGAGGLRTHLKITDSAGHILYAKEDATKGKFAFTTEDYDMFEVCFESKGTGRIPDQLVILDMKHGVEAKNYEEIAKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIFSMFCLIGLATWQVFYLRRFFKAKKLIE tmed7_rat Transmembrane emp24 domain-containing protein 7 Tmed7 p27 p24 family protein gamma-3 protein protein rat Rattus norvegicus (Rat) Rat MPRPRSATCWAAAAGRWSCRLLALLLLLLLPGPSGGSEITFELPDNAKQCFYEDITQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTFTHKTVYFDFQVGEDPPLFPSENRVSALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAYWSVGEALILLVVSIGQVFLLKSFFSDKRTTTTRVGS go45_rat Golgin-45 Basic leucine zipper nuclear factor 1 Blzf1 protein protein rat Rattus norvegicus (Rat) Rat MEKMTTLKSFESKGILTSTPIRGAGDGMETEEPPKSVEVTHGVQPINQHVLPSPRKKVPSDSPGVLQLGKILNEKTVEVEAVRIFVPKAAITHDIPTKSAKVKSLGHHREELHNQSEVVTDPRKELSEVKKVLEKLKNSERRLLQDKEGLSNQLRVQTEVNRELKKLLVASVGDDPQYHFERLAREKNQLILENEALGRNTAQLSEQLERMSIQCDVWRSKFLASRVMADELTNFRVVLQHQNRDAQSAIQDLLSEREQFRQEMISTQKFLEELLVSLQWGREQTYSPNTQPHSTADLALTNHRLAEAVHAHLLGNVGISHPKRTPATAEVCSTPAEKMAEKVLRILDPVACTESSPDNAFAESTLLTTKKNIGRFHPYTRYENITFNCCSHCQGELLAL gorasp2-tmed2 1188868 n/a 1188873 unspecified role unspecified role prey prey n/a 1188874 unspecified role unspecified role bait bait physical association physical association false false false 1B gorasp2-tmed2-1 1188868 n/a 1188875 unspecified role unspecified role prey prey n/a 1188874 unspecified role unspecified role bait bait physical association physical association false false false 1B gorasp1-tmed2 1188868 n/a 1188873 unspecified role unspecified role prey prey n/a 1188876 unspecified role unspecified role bait bait physical association physical association false false false 1B gorasp1-tmed2-1 1188868 n/a 1188875 unspecified role unspecified role prey prey n/a 1188876 unspecified role unspecified role bait bait physical association physical association false false false 1B golga2-tmed2 1188868 n/a 1188877 unspecified role unspecified role bait bait n/a 1188873 unspecified role unspecified role prey prey physical association physical association false false false 1B tmed10-gorasp2 1188869 n/a 1188874 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1188878 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 2D tmed10-tmed2-7 1188869 n/a 1188874 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1188873 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q63524:p.Val200_Val201delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 2D and 3A tmed2-tmed7 1188869 n/a 1188879 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1188874 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 2D tmed7-tmed9 1188869 n/a 1188874 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1188875 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 2D tmed2-gorasp2 1188870 n/a 1188873 unspecified role unspecified role bait bait c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q63524:p.Val200_Val201delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false n/a 1188874 unspecified role unspecified role prey prey physical association physical association false false false 2A and 3B Oligomerized p24 protein is necessary for the interaction tmed2-gorasp1 1188870 n/a 1188876 unspecified role unspecified role prey prey n/a 1188873 unspecified role unspecified role bait bait Q63524:p.Val200_Val201delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2B and 3A Oligomerized p24 protein is necessary for the interaction gorasp2-blzf1 1188871 n/a 1188874 unspecified role unspecified role bait bait n/a 1188875 unspecified role unspecified role prey prey n/a 1188873 unspecified role unspecified role prey prey n/a 1188878 unspecified role unspecified role prey prey n/a 1188880 unspecified role unspecified role prey prey physical association physical association false false false 1A tmed2-gorasp1-1 1188872 n/a 1188873 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q63524:p.Val200_Val201delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false n/a 1188876 unspecified role unspecified role prey prey direct interaction direct interaction false false false 2D and 3B