UniProt UniProt http://www.uniprot.org landriscina-2001-1 Copper induces the assembly of a multiprotein aggregate implicated in the release of fibroblast growth factor 1 in response to stress. in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom predetermined predetermined participant predetermined Landriscina M., Bagala C., Mandinova A., Soldi R., Micucci I., Bellum S., Prudovsky I., Maciag T. maciat@mmc.org J. Biol. Chem. (0021-9258) 2001 Only protein-protein interactions imex curation landriscina-2001-2 Copper induces the assembly of a multiprotein aggregate implicated in the release of fibroblast growth factor 1 in response to stress. in vitro In vitro comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Landriscina M., Bagala C., Mandinova A., Soldi R., Micucci I., Bellum S., Prudovsky I., Maciag T. maciat@mmc.org J. Biol. Chem. (0021-9258) 2001 Only protein-protein interactions imex curation landriscina-2001-3 Copper induces the assembly of a multiprotein aggregate implicated in the release of fibroblast growth factor 1 in response to stress. in vitro In vitro comigration in sds comigration in sds page comigration in sds polyclonal western polyclonal antibody western blot polyclonal western Landriscina M., Bagala C., Mandinova A., Soldi R., Micucci I., Bellum S., Prudovsky I., Maciag T. maciat@mmc.org J. Biol. Chem. (0021-9258) 2001 Only protein-protein interactions imex curation copper(2+) Copper (Cu2+) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) fgf1_human Fibroblast growth factor 1 Acidic fibroblast growth factor FGF1 FGFA Heparin-binding growth factor 1 Endothelial cell growth factor protein protein human Homo sapiens Human MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD s10ad_mouse Protein S100-A13 S100a13 S100 calcium-binding protein A13 protein protein mouse Mus musculus Mouse MAAETLTELEAAIETVVSTFFTFAGREGRKGSLNINEFKELATQQLPHLLKDVGSLDEKMKTLDVNQDSELRFSEYWRLIGELAKEVRKEKALGIRKK syt1_rat Synaptotagmin-1 Syt1 Synaptotagmin I p65 protein protein rat Rattus norvegicus (Rat) Rat MVSASHPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSKLKQKFMNELHKIPLPPWALIAIAIVAVLLVVTCCFCVCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK copper_2__-fgf1 1130503 n/a 1130506 unspecified role unspecified role bait bait n/a 1130507 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false fig 1 copper_2__-s10ad 1130503 n/a 1130508 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 1130506 unspecified role unspecified role bait bait direct interaction direct interaction false false false fig 1 copper_2__-syt1 1130503 n/a 1130509 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 1130506 unspecified role unspecified role bait bait direct interaction direct interaction false false false fig 1 fgf1-fgf1 1130504 n/a 1130507 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a 1130507 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false fig 2 copper_2__-fgf1-1 1130504 n/a 1130508 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1130507 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1130506 unspecified role unspecified role neutral component neutral component physical association physical association false false false fig 2 copper_2__-fgf1-2 1130505 n/a 1130508 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1130507 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1130509 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1130506 unspecified role unspecified role neutral component neutral component physical association physical association false false false fig 2