IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ jan-2000-1 Som1, a third component of the yeast mitochondrial inner membrane peptidase complex that contains Imp1 and Imp2. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Jan PS., Esser K., Pratje E., Michaelis G. michaelg@uni-duesseldorf.de Mol. Gen. Genet. (0026-8925) 2000 Only protein-protein interactions imex curation imp1_yeast Mitochondrial inner membrane protease subunit 1 IMP1 PET2858 YM9375.20C YMR150C protein protein yeast Saccharomyces cerevisiae Baker's yeast MTVGTLPIWSKTFSYAIRSLCFLHIIHMYAYEFTETRGESMLPTLSATNDYVHVLKNFQNGRGIKMGDCIVALKPTDPNHRICKRVTGMPGDLVLVDPSTIVNYVGDVLVDEERFGTYIKVPEGHVWVTGDNLSHSLDSRTYNALPMGLIMGKIVAANNFDKPFWDGSIRNIWGFKWINNTFLDVQAKSN som1_yeast Protein SOM1, mitochondrial SOM1 Mitochondrial inner membrane protease subunit SOM1 YEL059BC YEL059C-A protein protein yeast Saccharomyces cerevisiae Baker's yeast MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKRLFEHCIAPDKSATNYEVTDTYTNS imp1-som1 Interaction between Imp1 and Som1 1011883 n/a 1011884 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1011885 unspecified role unspecified role prey prey physical association physical association false false false Fig. 3B