IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ fukuda-1999-1 Conserved N-terminal cysteine motif is essential for homo- and heterodimer formation of synaptotagmins III, V, VI, and X. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 comigration in sds comigration in sds page comigration in sds anti tag western anti tag western blot anti tag western Fukuda M., Kanno E., Mikoshiba K. mnfukuda@brain.riken.go.jp J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation fukuda-1999-2 Conserved N-terminal cysteine motif is essential for homo- and heterodimer formation of synaptotagmins III, V, VI, and X. mouse-brain Mus musculus brain brain Brain [cerebrum] comigration in sds comigration in sds page comigration in sds western blot western blot Immuno blot Immuno blot Fukuda M., Kanno E., Mikoshiba K. mnfukuda@brain.riken.go.jp J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation syt1_mouse Synaptotagmin-1 Synaptotagmin I p65 Syt1 protein protein mouse Mus musculus Mouse MVSASRPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSKLKQKFMNELHKIPLPPWALIAIAIVAVLLVVTCCFCVCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK syt2_mouse Synaptotagmin-2 Syt2 Inositol polyphosphate-binding protein Synaptotagmin II protein protein mouse Mus musculus Mouse MRNIFKRNQEPNVAPATTTATMPLAPVAPADNSTESTGPGESQEDMFAKLKEKFFNEINKIPLPPWALIAMAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELAGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK syt3_mouse Synaptotagmin-3 Syt3 Synaptotagmin III protein protein mouse Mus musculus Mouse MSGDYEDDLCRRALILVSDLCARVRDADTNDRCQEFNELRIRGYPRGPDADISVSLLSVIVTFCGIVLLGVSLFVSWKLCWVPWRDKGGSAVGGGPLRKDLAPGVGLAGLVGGGGHHLGASLGGHPLLGGPHHHGHTAHHPPFAELLEPGGLGGSEPPEPSYLDMDSYPEAAVASVVAAGVKPSQTSPELPSEGGTGSGLLLLPPSGGGLPSAQSHQQVTSLAPTTRYPALPRPLTQQTLTTQADPSTEERPPALPLPLPGGEEKAKLIGQIKPELYQGTGPGGRRGGGSGEAGAPCGRISFALRYLYGSDHLVVRILQALDLPAKDSNGFSDPYVKIYLLPDRKKKFQTKVHRKTLNPIFNETFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVVLDNLLELAEQPPDRPLWRDILEGGSEKADLGELNFSLCYLPTAGRLTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAVVDYDCIGHNEVIGVCRVGPEAADPHGREHWAEMLANPRKPVEHWHQLVEEKTLSSFTKGGKGLSEKENSE syt4_mouse Synaptotagmin-4 Syt4 Syt3 Synaptotagmin IV protein protein mouse Mus musculus Mouse MAPITTSRVEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRRSAKSNKTPPYKFVHVLKGVDIYPENLSSKKKFGGDDKSEVKGKAALPNLSLHLDLEKRDLNGNFPKANPKAGSSSDLENVTPKLFTETEKEANSPESLKSSTSLTSEEKQEKLGTLFLSLEYNFEKKAFVVNIKEAQGLPAMDEQSMTSDPYIKMTILPEKKHRVKTRVLRKTLDPVFDETFTFYGIPYPHIQELSLHFTVLSFDRFSRDDVIGEVLIPLSGIELSDGKMLMTREIIKRNAKKSSGRGELLVSLCYQSTTNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVFDIPCESLEEISVEFLVLDSERGSRNEVIGRLVLGATAEGSGGGHWKEICDFPRRQIAKWHMLCDG syt5_mouse Synaptotagmin-5 Synaptotagmin V Synaptotagmin IX Syt5 Syt9 protein protein mouse Mus musculus Mouse MFPEPPTLGSPAPKTPPDSSRIRQGAVPAWVLATIVLGSGLLVFSSCFCLYRKRCRRRMGKKSQAQAQVHLQEVKELGRSYIDKVQPEIEELDRSPSMPGQQVSDKHQLGRLQYSLDYDFQTGQLLVGILQAQGLAALDLGGSSDPYVSVYLLPDKRRRHETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDRFSRNDAIGEVRVPMSSVNLGRPVQAWRELQVAPKEEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGGKKVRKKKTTIKKNTLNPYYNEAFSFEVPCDQVQKVQVELTVLDYDKLGKNEAIGRVAVGAAVGGAGLRHWADMLANPRRPIAQWHSLRPPDRARPIPAP syt9_mouse Synaptotagmin-9 Syt9 Syt5 Synaptotagmin IX Synaptotagmin V protein protein mouse Mus musculus Mouse MPGARDALCHQALQLLAELCARGALEHDSCQDFIYHLRDRARPRLRDPDISVSLLTLVVTACGLALFGVSLFVSWKLCWVPWRERGLFSGSKDNNQEPLNYTDTETNEQENSEDFLDPPTPCPDSSMKISHTSPDIPLSTQPGGQENCAHAVRVQRQVTEPTPSARHNSIRRQLNLSNPDFNIQQLQRQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDFSGTSDPYVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVHYNDLEARKLHFSVYDFDRFSRHDLIGQVVVDHFFDLADFPRECILWKDIEYVTNDNVDLGELMFSLCYLPTAGRLTITIIKARNLKAMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYNEAIVFDVPPESIDQIHLSIAVMDYDRVGHNEVIGVCQVGNEAERLGRDHWSEMLSYPRKPIAHWHSLMEKR syt6_mouse Synaptotagmin-6 Syt6 Synaptotagmin VI protein protein mouse Mus musculus Mouse MSGVWGAGGPRCQAALAVLASLCRARPPPLGLDVETCRSFELQSPEQSPSAADSGTSVSLLAVVVIVCGVALVAVFLFLFWKLCWMPWRKKEASSPSSANPASETLQSPSSRGNMADKLKDPSALGFLEAAVKISHTSPDIPAEVQMSVKEHIMRHTKLQRQTTEPASSTRHTSFKRHLPRQMHVSSVDYGNELPPAAAEQPTSIGRIKPELYKQKSVDGDDAKSEAAKSCGKINFSLRYDYESETLIVRILKAFDLPAKDFCGSSDPYVKIYLLPDRKCKLQTRVHRKTLNPTFDENFHFPVPYEELADRKLHLSVFDFDRFSRHDMIGEVILDNLFEASDLSRETSIWKDIQYATSESVDLGEIMFSLCYLPTAGRLTLTVIKCRNLKAMDITGYSDPYVKVSLLCDGRRLKKKKTTIKKNTLNPIYNEAIIFDIPPENMDQVSLLISVMDYDRVGHNEIIGVCRVGINAEGLGRDHWNEMLAYPRKPIAHWHSLVEVKKSFKEGTPRL syt7_mouse Synaptotagmin-7 Synaptotagmin VII Syt7 protein protein mouse Mus musculus Mouse MYRDPEAASPGAPTRDVLLVSAIITVSLSVTIVLCGLCHWCQRKLGKRYKNSLETVGTPDSGRGRGEKKAIKLPAGGKAVNTAPVPGQTPHDESDRRTETRSSVSDLVNSLTSEMLMLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKVMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRVLYLQVLDYDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTKKRNLNPIFNESFAFDIPTEKLRETTIIITVMDKDKLSRNDVIGKIYLSWKSGPGEVKHWKDMIARPRQPVAQWHQLKA syt8_mouse Synaptotagmin-8 Syt8 Synaptotagmin VIII protein protein mouse Mus musculus Mouse MQADRSMKMGHALNPFSTSAPLDATAGPSLIPDLITRIPWPRWTLFIAILAAGVLLVSCLLCVICCYCHRHRHRKQPKDKETVGLGSARNSTTTHLVQPDVDCLEPCSGGDQQWGRLLLSLEYDFGSQEIRVGLRQAGNLKAEGTADPYAWVSVSTQSGRRHETKVHRGTLSPMFEETCCFLVPPAELPKATLKVQLWDFKRFSEHEPLGELQLPLGTVDLQHVLESWYQLGPPGTTEPEQMGELCFSLRYVPSSGSLTVVVLEARGLNPGLAEAYVKIQLMLNQRKWKKSKTSSKKGTTTPYFNEAFVFLVPVSQLQSVDLVLAVWARGLQLRTEPVGKVLLGSRASGQPLQHWADMLAHARRPIAQWHHLRSPREVDRVLALQPRLPLLRPRS syt10_mouse Synaptotagmin-10 Syt10 Synaptotagmin X protein protein mouse Mus musculus Mouse MSFRKEDGVSSLCQKALHIITELCFAGQVEWDKCSGIFPADRSGQGGGGTDISVSLLAVVVSFCGLALLVVSLFVFWKLCWPCWKSKLVAPNLSVLPQSISSAPTEVFETEEKKEVEENEKPAPKAIEPAIKISHTSPDIPAEVQTALKEHLIKHARVQRQTTEPTSSSRHNSFRRHLPRQMNVSSVDFSVGTEPILQRGETRTSIGRIKPELYKQKSVDSEGNRKDDVKTCGKLNFALQYDYENELLVVKIIKALDLPAKDFTGTSDPYVKIYLLPDRKKKFQTRVHRKTLNPLFDELFQFPVVYDQLSNRKLHFSIYDFDRFSRHDMIGEVILDNLFEVSDLSREATVWKDIHCATTESIDLGEIMFSLCYLPTAGRMTLTVIKCRNLKAMDITGSSDPYVKVSLMCEGRRLKKRKTTTKKNTLNPVYNEAIIFDIPPENVDQVSLCIAVMDYDRVGHNEVIGVCRTGLDAEGLGRDHWNEMLAYHRKPITHWHPLLELPGRATSFDSQGSCSSPRPPSTP syt11_mouse Synaptotagmin-11 Synaptotagmin XI Syt11 protein protein mouse Mus musculus Mouse MAEITNIRPSFDVSPVAAGLIGASVLVVCVSVTVFVWTCCHQQAEKKHKTPPYKFIHMLKGISIYPETLSNKKKIIKVRRDKDGPRRESGRGNLLINAESGLLSHDKDPRGPSPASCMDQLPIKRDYGEELRSPMTSLTPGESKATSPSSPEEDVMLGSLTFSVDYNFPKKALVVTIQEAHGLPVMDDQTQGSDPYIKMTILPDKRHRVKTRVLRKTLDPVFDETFTFYGIPYSQLQDLVLHFLVLSFDRFSRDDVIGEVMVPLAGVDPSTGKVQLTRDIIKRNIQKCISRGELQVSLSYQPVAQRMTVVVLKARHLPKMDITGLSGNPYVKVNVYYGRKRIAKKKTHVKKCTLNPVFNESFIYDIPTDLLPDISIEFLVIDFDRTTKNEVVGRLILGAHSVTTSGAEHWREVCESPRKPIAKWHSLSEY syt1-syt1-5 1233185 n/a 1233187 unspecified role unspecified role neutral component neutral component n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 2.0 physical association physical association false false false Fig. 2 syt2-syt2 1233185 n/a 1233188 unspecified role unspecified role neutral component neutral component n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 2.0 physical association physical association false false false Fig. 2 syt3-syt3 1233185 n/a 1233189 unspecified role unspecified role neutral component neutral component n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 2.0 physical association physical association false false false Fig. 2 The dimer band of Syt III was difficult to see on 10% polyacrylamide gel, but could be detected on 7.5% gel syt3-1 1233185 n/a 1233189 unspecified role unspecified role neutral component neutral component n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false O35681:p.[Cys10Ala;Cys21Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false O35681:p.Cys10Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O35681:p.[Cys10Ala;Cys21Ala;Cys33Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.0 physical association physical association false false false Fig. 4A The dimer band of Syt III was difficult to see on 10% polyacrylamide gel, but could be detected on 7.5% gel syt3-syt3-1 1233185 n/a 1233189 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false O35681:p.Cys10Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.0 n/a 1233189 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 5 The dimer band of Syt III was difficult to see on 10% polyacrylamide gel, but could be detected on 7.5% gel syt4-syt4 1233185 n/a 1233190 unspecified role unspecified role neutral component neutral component n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 2.0 physical association physical association false false false Fig. 2 syt5-syt5 1233185 n/a 1233191 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 physical association physical association false false false Fig. 2 syt9-syt3 1233185 n/a 1233192 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1233189 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false O35681:p.Cys10Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 5 Nomenclature of Syt5/9 are confused in that each is a synonym for the other. Mapping of Cys-9 confirms that Syt5 in the paper is Syt9. syt3-syt9 1233185 n/a 1233189 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1233192 unspecified role unspecified role prey prey Q9R0N9:p.Cys9Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 5 Nomenclature of Syt5/9 are confused in that each is a synonym for the other. Mapping of Cys-9 confirms that Syt5 in the paper is Syt9. syt6-syt6 1233185 n/a 1233193 unspecified role unspecified role neutral component neutral component n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 2.0 physical association physical association false false false Fig. 2 syt6-syt3 1233185 n/a 1233189 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false O35681:p.Cys10Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 1233193 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 5 syt6-syt9 1233185 n/a 1233192 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9R0N9:p.Cys9Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 1233193 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 5 Nomenclature of Syt5/9 are confused in that each is a synonym for the other. Mapping of Cys-9 confirms that Syt5 in the paper is Syt9. syt6-syt6-2 1233185 n/a 1233193 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9R0N8:p.Cys12Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 1233193 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 5 syt9-syt6 1233185 n/a 1233192 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1233193 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9R0N8:p.Cys12Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 5 Nomenclature of Syt5/9 are confused in that each is a synonym for the other. Mapping of Cys-9 confirms that Syt5 in the paper is Syt9. syt3-syt6 1233185 n/a 1233193 unspecified role unspecified role prey prey Q9R0N8:p.Cys12Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1233189 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 5 syt7-syt7 1233185 n/a 1233194 unspecified role unspecified role neutral component neutral component n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 2.0 physical association physical association false false false Fig. 2 syt8-syt8 1233185 n/a 1233195 unspecified role unspecified role neutral component neutral component n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 2.0 physical association physical association false false false Fig. 2 syt9-syt9 1233185 n/a 1233192 unspecified role unspecified role neutral component neutral component n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 2.0 physical association physical association false false false Fig. 2 syt9-syt9-1 1233185 n/a 1233192 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9R0N9:p.Cys9Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 1233192 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 5 Nomenclature of Syt5/9 are confused in that each is a synonym for the other. Mapping of Cys-9 confirms that Syt5 in the paper is Syt9. syt10-syt10 1233185 n/a 1233196 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 physical association physical association false false false Fig. 2 syt3-syt10 1233185 n/a 1233189 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1233196 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9R0N4:p.Cys13Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 5 syt10-syt6 1233185 n/a 1233196 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1233193 unspecified role unspecified role prey prey Q9R0N8:p.Cys12Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 5 syt9-syt10 1233185 n/a 1233196 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9R0N4:p.Cys13Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 1233192 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 5 syt6-syt10 1233185 n/a 1233196 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9R0N4:p.Cys13Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 1233193 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 5 syt10-syt10-2 1233185 n/a 1233196 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9R0N4:p.Cys13Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 1233196 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 5 syt10-syt9 1233185 n/a 1233192 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9R0N9:p.Cys9Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 1233196 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 5 Nomenclature of Syt5/9 are confused in that each is a synonym for the other. Mapping of Cys-9 confirms that Syt5 in the paper is Syt9. syt10-syt3 1233185 n/a 1233196 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1233189 unspecified role unspecified role prey prey O35681:p.Cys10Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 5 Nomenclature of Syt5/9 are confused in that each is a synonym for the other. Mapping of Cys-9 confirms that Syt5 in the paper is Syt9. syt11-syt11 1233185 n/a 1233197 unspecified role unspecified role neutral component neutral component n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 2.0 physical association physical association false false false Fig. 2 syt3-syt3-2 1233186 n/a 1233189 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 physical association physical association false false false Fig. 6 Homodimerisation is beta-mercaptoethanol-sensitive