IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lee-1999b-1 Imp3p and Imp4p, two specific components of the U3 small nucleolar ribonucleoprotein that are essential for pre-18S rRNA processing. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lee SJ., Baserga SJ. susan.baserga@yale.edu Yeast cDNA Mol. Cell. Biol. (0270-7306) 1999 lee-1999b-2 Imp3p and Imp4p, two specific components of the U3 small nucleolar ribonucleoprotein that are essential for pre-18S rRNA processing. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lee SJ., Baserga SJ. susan.baserga@yale.edu Yeast cDNA Mol. Cell. Biol. (0270-7306) 1999 lee-1999b-3 Imp3p and Imp4p, two specific components of the U3 small nucleolar ribonucleoprotein that are essential for pre-18S rRNA processing. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lee SJ., Baserga SJ. susan.baserga@yale.edu Yeast cDNA Mol. Cell. Biol. (0270-7306) 1999 lee-1999b-4 Imp3p and Imp4p, two specific components of the U3 small nucleolar ribonucleoprotein that are essential for pre-18S rRNA processing. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip northern blot northern blot northen Lee SJ., Baserga SJ. susan.baserga@yale.edu Yeast cDNA Mol. Cell. Biol. (0270-7306) 1999 lee-1999b-5 Imp3p and Imp4p, two specific components of the U3 small nucleolar ribonucleoprotein that are essential for pre-18S rRNA processing. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip northern blot northern blot northen Lee SJ., Baserga SJ. susan.baserga@yale.edu Yeast cDNA Mol. Cell. Biol. (0270-7306) 1999 imp3_yeast U3 small nucleolar ribonucleoprotein protein IMP3 IMP3 Interacting with MPP10 protein 3 YHR148W protein protein yeast Saccharomyces cerevisiae Baker's yeast MVRKLKHHEQKLLKKVDFLEWKQDQGHRDTQVMRTYHIQNREDYHKYNRICGDIRRLANKLSLLPPTDPFRRKHEQLLLDKLYAMGVLTTKSKISDLENKVTVSAICRRRLPVIMHRLKMAETIQDAVKFIEQGHVRVGPNLINDPAYLVTRNMEDYVTWVDNSKIKKTLLRYRNQIDDFDFS 2CA16A3425691DBD mpp10_yeast U3 small nucleolar RNA-associated protein MPP10 MPP10 YJR002W J1411 YJR83.5 M phase phosphoprotein 10 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSELFGVLKSNAGRIILKDPSATSKDVKAYIDSVINTCKNGSITKKAELDEITVDGLDANQVWWQVKLVLDSIDGDLIQGIQELKDVVTPSHNLSDGSTLNSSSGEESELEEAESVFKEKQMLSADVSEIEEQSNDSLSENDEEPSMDDEKTSAEAAREEFAEEKRISSGQDERHSSPDPYGINDKFFDLEKFNRDTLAAEDSNEASEGSEDEDIDYFQDMPSDDEEEEAIYYEDFFDKPTKEPVKKHSDVKDPKEDEELDEEEHDSAMDKVKLDLFADEEDEPNAEGVGEASDKNLSSFEKQQIEIRKQIEQLENEAVAEKKWSLKGEVKAKDRPEDALLTEELEFDRTAKPVPVITSEVTESLEDMIRRRIQDSNFDDLQRRTLLDITRKSQRPQFELSDVKSSKSLAEIYEDDYTRAEDESALSEELQKAHSEISELYANLVYKLDVLSSVHFVPKPASTSLEIRVETPTISMEDAQPLYMSNASSLAPQEIYNVGKAEKDGEIRLKNGVAMSKEELTREDKNRLRRALKRKRSKANLPNVNKRSKRNDVVDTLSKAKNITVINQKGEKKDVSGKTKKSRSGPDSTNIKL DEAF52FC003A0FFD imp4_yeast U3 small nucleolar ribonucleoprotein protein IMP4 IMP4 YNL075W N2353 Interacting with MPP10 protein 4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLRRQARERREYLYRKAQELQDSQLQQKRQIIKQALAQGKPLPKELAEDESLQKDFRYDQSLKESEEADDLQVDDEYAATSGIMDPRIIVTTSRDPSTRLSQFAKEIKLLFPNAVRLNRGNYVMPNLVDACKKSGTTDLVVLHEHRGVPTSLTISHFPHGPTAQFSLHNVVMRHDIINAGNQSEVNPHLIFDNFTTALGKRVVCILKHLFNAGPKKDSERVITFANRGDFISVRQHVYVRTREGVEIAEVGPRFEMRLFELRLGTLENKDADVEWQLRRFIRTANKKDYL u3_yeast_snrna Yeast (S.cerevisiae) U3 small nuclear RNA. snrna small nuclear rna snRNA snrna yeast Saccharomyces cerevisiae Baker's yeast GTCGACGTACTTCATAGGATCATTTCTATAGGAATCGTCACTCTTTGACTCTTCAAAAGAGCCACTGAATCCAACTTGGTTGATGAGTCCATAACCTTTGTACCCCAGAGTGAGAAACCGAAATTGAATCTAAATTAGCTTGGTCCGCAATCCTTAGCGGTTCGGCCATCTATAATTTTGAATAAAAATTTTGCTTTGGCGTTGCATTTGTAGTTTTTTCCTTTGGAAGTAATTACAATATTTTATGGCGCGATGATCTTGACCCATCCTATGTACTTCTTTTTTGAAGGGATAGGGCTCTATGGGTGGGTACAAATGGCAGTCTGACAAGT mpp10-imp3-1 1011920 n/a 1011925 unspecified role unspecified role prey prey n/a 1011926 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false mpp10-imp4-1 1011920 n/a 1011926 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1011927 unspecified role unspecified role prey prey physical association physical association false false false mpp10-imp3-2 1011921 n/a 1011925 unspecified role unspecified role prey prey n/a 1011926 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 2 mpp10-imp4-2 1011921 n/a 1011927 unspecified role unspecified role prey prey n/a 1011926 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 2 mpp10-imp3-3 1011922 n/a 1011926 unspecified role unspecified role prey prey n/a 1011925 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 7B mpp10-imp4-3 1011922 n/a 1011927 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1011926 unspecified role unspecified role prey prey physical association physical association false false false Fig. 7B imp3-u3-1 1011923 n/a 1011928 unspecified role unspecified role prey prey n/a 1011925 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 8A imp4-u3-1 1011923 n/a 1011927 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1011928 unspecified role unspecified role prey prey physical association physical association false false false Fig. 7B mpp10-u3-1 1011924 n/a 1011928 unspecified role unspecified role prey prey n/a 1011926 unspecified role unspecified role bait bait physical association physical association false false false Fig. 8A