MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint loeber-2010-2 Interaction of 42Sp50 with the vegetal RNA localization machinery in Xenopus laevis oocytes. xenla-oocyte Xenopus laevis oocyte Oocyte anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Loeber J., Claussen M., Jahn O., Pieler T. FEBS J. (1742-464X) 2010 Only protein-protein interactions imex curation loeber-2010-1 Interaction of 42Sp50 with the vegetal RNA localization machinery in Xenopus laevis oocytes. xenla-oocyte Xenopus laevis oocyte Oocyte tap tandem affinity purification TAP TAP tap predetermined predetermined participant predetermined Loeber J., Claussen M., Jahn O., Pieler T. FEBS J. (1742-464X) 2010 Only protein-protein interactions imex curation loeber-2010-3 Interaction of 42Sp50 with the vegetal RNA localization machinery in Xenopus laevis oocytes. in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation predetermined predetermined participant predetermined Loeber J., Claussen M., Jahn O., Pieler T. FEBS J. (1742-464X) 2010 Only protein-protein interactions imex curation if23a_xenla Insulin-like growth factor 2 mRNA-binding protein 3-A KH domain-containing transcription factor B3-A Vg1 localization element binding protein A Vg1 RNA-binding protein A RNA-binding protein Vera-A VLE-binding protein A VgLE-binding and ER association protein A 69 kDa RNA-binding protein A Trans-acting factor B3-A VICKZ family member 3-A IGF-II mRNA-binding protein 3-A igf2bp3-a vera-a vickz3-a protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MNKLYIGNLSENVSPTDLESLFKESKIPFTGQFLVKSGYAFVDCPDETWAMKAIDTLSGKVELHGKVIEVEHSVPKRQRSRKLQIRNIPPHLQWEVLDSLLAQYGTVENCEQVNTESETAVVNVTYANKEHARQGLEKLNGYQLENYSLKVTYIPDEMATPQAPSQQLQQQPQQQHPQGRRGFGQRGPARQGSPGAAARPKPQTEVPLRMLVPTQFVGAIIGKEGATIRNITKQTQSKIDIHRKENAGAAEKPITIHSTPEGCSAACKIIMEIMQKEAQDTKFTEEIPLKILAHNNFVGRLIGKEGRNLKKIEQDTDTKITISPLQDLTLYNPERTITVKGSIEPCAKAEEEIMKKIRESYENDIAAMNLQAHLIPGLNLNALGLFPSSSSGMPPPSVGVPSPTSSTSYPPFGQQPESETVHLFIPALAVGAIIGKQGQHIKQLSRFAGASIKIAPAEGPDAKLRMVIITGPPEAQFKAQGRIYGKLKEENFFGPKEEVKLETHIKVPSYAAGRVIGKGGKTVNELQNLTSAEVVVPRDQTPDENDEVVVKITGHFYASQLAQRKIQEILAQVRRQQQQQQKTVQSGQPQPRRK epaba_xenla Embryonic polyadenylate-binding protein A epabp-a XePABP-A epab protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MNATGAGYPLASLYIGDLHPDVTEAMLYEKFSPAGPIMSIRVCRDIATRRSLSYAYINFQQPADAERALDTMNFEVIKGRPIRIMWSQRDPGLRKSGVGNVFIKNLDESIDNKALYDTFSAFGNILSCKVVCDEHGSRGYGFVHFETHEAANRAIQTMNGMLLNDRKVFVGHFKSRRERELEYGAKVMEFTNVYIKNFGEDMDDKRLREIFSAFGNTLSVKVMMDDSGRSRGFGFVNYGNHEEAQKAVSEMNGKEVNGRMIYVGRAQKRIERQSELKRKFEQIKQERINRYQGVNLYVKNLDDGIDDDRLRKEFLPYGTITSAKVMTEGGHSKGFGFVCFSSPEEATKAVTEMNGRIVSTKPLYVALAQRKEERKAILTNQYMQRLATMRAMPGPLLGSFQQPANYFLSAMPQPPNRTFYSPNPVAPVRPAPQWASHQSRPPQYQPPTPLMRAVQPRRMSSNISTMKQASTQVPRVAQHSQRVANIGTQTAGARAQVNPSMMRTMPHYKYSCGVRNVQPIVSSTHLQQVMEPAVLMQGQEPLTASLLAGAPPQEQKQMLGERIYPVIHEMHPTLAGKITGMLLEIDNSELLHMLESPESLHSKVEEAVAVLQAHQAKENAQKSAQPSLI mint ybx2b_xenla Y-box-binding protein 2-B ybx2-b frgy2-b Cytoplasmic RNA-binding protein p54 Frog Y-box protein 2-B Messenger ribonucleoprotein particle 3 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSEAEPRETEAVTQPEPAPEIHKPDIVPPRNQINKKLLATQVQGTVKWFNVRNGYGFINRNDSKEDVFVHQTAIKKNNPRKFLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVKGSRFAPNRRRFRRQFYRPRADTAGESGGEGVSPEQMSEGEKGEETSPQQRPQRRRPPPFFYRRRFRRGPRPNNQQNQGAEVTDQSENKDPAAPTSEALASGDGQQRPPPRRFQQRFRRPFRPRPPPPQTPEGGDGEAKAEGEPQRQRNRPYVQRRRRQQPPTVQGESKAEPSEHPASEEGTPSDAPTDDGAPVETSEAGVEDTTAPE mint ef1a1_xenla Elongation factor 1-alpha 42Sp50 Thesaurin A protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MTDKAPQKTHLNIVIIGHVDSGKSTTTGHLIYKCGGFDPRALEKVEAAAAQLGKSSFKFAWILDKLKAERERGITIDISLWKFQTNRFTITIIDAPGHRDFIKNMITGTSQADVALLVVSAATGEFEAGVSRNGQTREHALLAYTMGVKQLIVCVNKMDLTDPPYSHKRFDEVVRNVMVYLKKIGYNPATIPFVPVSGWTGENISSPSQKMGWFKGWKVKRKDGFTKGQSLLEVLDALVPPVRPANKPLRLPLQDVYKIGGIGTVPVGKIETGILKPGMTISFAPSGFSAEVKSIEMHHEPLQMAFPGFNIGFNVKNIAVKSLKRGNVAGNSKSDPPTEASSFTAQVIILNHPGFIKAGYSPVIDCHTAHITCQFAELQEKIDRRTGKKLEDNPGLLKSGDAAIITLKPIKPFCVERFFDYPPLGRFAARDLKQTVAVGVVKSVEHKAGAAARRQVQKPVLVK mint q5mnu4_xenla stau1.L Stau1 stau1 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MDVTMSQAPKSPAAPLPKIQILNKNQHSPLPQPLSIPSTASPLPSENAGRPLQNSALPSPSVTSSGPTAVSSNMANPKEKTPMCLVNELARFNKIQPVYKLLSEQGPAHSKVIPLGRWQDYSLLERVGEERPRQMFTVQLTLGDQYWEAEGTSIKKAQHAAAAKALEGTKYPKPTVRPVRGERKYPDSITPTVELNALCMKLGRKPIYKPLDPYTGIRSAYNYNMRGGGYPPRYFYPFPVAPILYQVELSVGGQQFHGKGRTRQAAKHDAAARALKSLHHEPLPDKPALNGKAADEENLNKSEISQVFEIALKRNMSVNFEVTKETGPPHMKSFLTKVIVGEFLGEGEGKSKKISKKNAAIAVLEELRKLPPLPTVEKMRPKIKKKTKSIVKLPTSPEYGQGMNPISRLAQIQQAKKGKEPEYILITERGLPRRREFVMQVKVGNHAAEGSGTNKKVAKRNAAENMLEILGFKVPPPPPKPALKTEEKLPVKKPGDGRKVTFYEPGSGEDGANHNKDDEFRMPYHSHQQLPAGILPMVPEVAQAVGVNQGLHTKEFNRVAPNPAKATVTAMIARELLYAGISPTADTILKNNNAAGHVLRGPFTRPSEQLNYLSRVQGLEVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQNPEMPRTGNGPMSVCVKPEMESDPLLKPANSNTLGQTLDSTA mint elv1a_xenla ELAV-like protein 1-A elavl1-a elavl1 elrA Protein ElrA-A 36 kDa embryonic-type cytoplasmic polyadenylation element-binding protein protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSNGYEDHMDDVCRDDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGFEMRSSSLSKGHSLGYGFVNYLNAKDAERAINTLNGLRLQSKTIKVSFARPSSESIKDANLYISGLPRTMTQKDVEDMFLPFGHIINSRVLVDQATGLSRGVAFIRFDKRSEAEEAIASFNGHKPPGSSEPITVKFAANPNQNKNVALLSQICHSPARRFGGPVHHQAQRFRFSPMGVDHMSSISSVNVASSATSGWCIFVYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKTLQVSFKTSKSHK mint q6gm69_xenla hnrnpab.S XELAEV_18021534mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSDSEQQYMETNAENGHEACDAEAAEGKGAGGGQNDAEGDQINASKGEEEAGCVAEISSPLTEGVKMFVGGLSWDTSKKDLKDYFEKFGEVSDCTIKMDPNTGRSRGFGFILFKDAASVDKVLEHKEHRLDGRLIDPKKAMAMKKEPIKKIFVGGLNPEAGEDKIREYFETFGEIEAVELPMDPKTNKRRGFVFITFKEEEPVKKILEKKFHNVSGSKCEIKIAQPKEVYQQQYGGRGGSFGGRGGRGGKGQGQNWNQGYNNYWNQGYGNQGYGSYGQQGYGGYGNYDYSGYGYYGYGPGYDYSQGGANYGKAPRRGGHQSNYKPY mint q9pts5_xenla ptbp1.L VgRBP60 ptbp1 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MEGIVQDITVGTKRGSDELFSCVTNGPFIMSNAAAGENLYGSNGNDSKKFKGDGRSVAVGSRVIHLRKLPGDVTEAEVISLGLPFGKVTNILMLKGKNQAFLEMSTEEAANTMISYYTNVAPVLRSQPIYIQYSNHKELKTDDSPNQARAQAALQAVNSVVSGTTALSASAAAVDVGIAMSGQSPVLRIIVENLFYPVTLDVLQQIFSKFGTVLKIITFTKNNQFQALLQYGDPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDGQPSLDQTIAAFGAPGLISANPYAGAGFHPAFAIPQGVHGLAPLTLPSAAAAAAAAAGRLGIHGLGIPGNSVLLVSNLNPERVTPQCLFILFGVYGDVHRVKILFNKKENALVQMADGNQAQLAMSHLNGQRLHGKPLRTTVSKHQTVQLPREGQEDQGLTKDYSTSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLKILFSNNGYAVKGFKFFQKDRKMALIQMGSVEEAIESLIELHNHDMGENHHHRVSFSKSTI mint elav2_xenla ELAV-like protein 2 elavl2 el-1 elavl2-a elrB Protein ElrB Elav like-1 p45 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MAVRLCDVASLLRSGSWAAEPWTGQVIAAMETQLSNGPTCNNTANCPNTINCSSPVESNNTEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITEGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPPGATEPITVKFANNPSQKVNHTILSQLYQSPNRRYPGPLAQQAQRFRLDNLLNMAYGGIKSRFSPMAIDGMTSLAGINFPGHAGTGWCIFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTSKTHKA mint epabp_a-igf2bp3_a 978157 if23a_xenla Vg1RBP 978160 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level epaba_xenla epab 978161 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2 mint ybx2_b-igf2bp3_a 978157 if23a_xenla Vg1RBP 978160 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level ybx2b_xenla frgy2-b 978162 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2 mint ef1a1-igf2bp3_a 978157 if23a_xenla Vg1RBP 978160 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level ef1a1_xenla 42Sp50 978163 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2 mint ef1a1-igf2bp3_a-1 978157 if23a_xenla Vg1RBP 978160 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level q5mnu4_xenla staufen 978164 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level ef1a1_xenla 42Sp50 978163 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false f3 mint igf2bp3_a-ef1a1 978158 if23a_xenla Vg1RBP 978160 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level if23a_xenla Vg1RBP 978160 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level tap tagged tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ef1a1_xenla 42Sp50 978163 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level epaba_xenla epab 978161 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level ybx2b_xenla frgy2-b 978162 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false f1a mint igf2bp3_a-elavl1_a 978158 if23a_xenla Vg1RBP 978160 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level tap tagged tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false if23a_xenla Vg1RBP 978160 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level elv1a_xenla ElrA 978165 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level q6gm69_xenla 40LoVe 978166 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level q5mnu4_xenla staufen 978164 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level q9pts5_xenla hnRNPI 978167 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level elav2_xenla elrB 978168 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false f1b mint ef1a1-igf2bp3_a-2 978159 if23a_xenla Vg1RBP 978160 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level q5mnu4_xenla staufen 978164 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level ef1a1_xenla 42Sp50 978163 anti tag western anti tag western blot anti tag western unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q6gm69_xenla 40LoVe 978166 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false f4 mint