MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint gupta-2010-3 Growth factor receptor-bound protein 14: a new modulator of photoreceptor-specific cyclic-nucleotide-gated channel. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Gupta VK., Rajala A., Daly RJ., Rajala RV. EMBO Rep. (1469-221X) 2010 Only protein-protein interactions imex curation gupta-2010-4 Growth factor receptor-bound protein 14: a new modulator of photoreceptor-specific cyclic-nucleotide-gated channel. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Gupta VK., Rajala A., Daly RJ., Rajala RV. EMBO Rep. (1469-221X) 2010 Only protein-protein interactions imex curation gupta-2010-1 Growth factor receptor-bound protein 14: a new modulator of photoreceptor-specific cyclic-nucleotide-gated channel. rat-retina Rattus norvegicus retina retinal tissue anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Gupta VK., Rajala A., Daly RJ., Rajala RV. EMBO Rep. (1469-221X) 2010 Only protein-protein interactions imex curation gupta-2010-2 Growth factor receptor-bound protein 14: a new modulator of photoreceptor-specific cyclic-nucleotide-gated channel. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Gupta VK., Rajala A., Daly RJ., Rajala RV. EMBO Rep. (1469-221X) 2010 Only protein-protein interactions imex curation cnga1_human cGMP-gated cation channel alpha-1 CNGA1 CNCG CNCG1 Rod photoreceptor cGMP-gated channel subunit alpha Cyclic nucleotide-gated channel alpha-1 Cyclic nucleotide-gated channel, photoreceptor Cyclic nucleotide-gated cation channel 1 protein protein human Homo sapiens Human MKLSMKNNIINTQQSFVTMPNVIVPDIEKEIRRMENGACSSFSEDDDSASTSEESENENPHARGSFSYKSLRKGGPSQREQYLPGAIALFNVNNSSNKDQEPEEKKKKKKEKKSKSDDKNENKNDPEKKKKKKDKEKKKKEEKSKDKKEEEKKEVVVIDPSGNTYYNWLFCITLPVMYNWTMVIARACFDELQSDYLEYWLILDYVSDIVYLIDMFVRTRTGYLEQGLLVKEELKLINKYKSNLQFKLDVLSLIPTDLLYFKLGWNYPEIRLNRLLRFSRMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVFYSISKAIGFGNDTWVYPDINDPEFGRLARKYVYSLYWSTLTLTTIGETPPPVRDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQARIDAIKQYMHFRNVSKDMEKRVIKWFDYLWTNKKTVDEKEVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGKQILMKDGLLDLNIANAGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVEKFLKPLIDTEFSSIEGPGAESGPIDST Visual signal transduction is mediated by a G-protein coupled cascade using cGMP as second messenger. This protein can be activated by cyclic GMP which leads to an opening of the cation channel and thereby causing a depolarization of rod photoreceptors Defects in CNGA1 are a cause of retinitis pigmentosa autosomal recessive (ARRP) [MIM:268000]. RP leads to degeneration of retinal photoreceptor cells. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well mint grb14_bovin Growth factor receptor-bound protein 14 GRB14 GRB14 adapter protein protein protein bovin Bos taurus (Bovine) Bovine MTTSLQDGQSAAGRAAARDSPLAAQVCGAAQGRGDARDLAPAPWLHARALLPPPDATRGCAADRRKKKDLDVLEMPSIPNPFPELCCSPFTSVLSAGLFPKANSRKKQVIKVYSEDETSRALEVPSDITARDVCQLLILKNHYIDDHSWTLFEHLPHVGLERTIEDHELVIEVLSNWGMEEENKLYFRKNYAKYEFFKNPMYFFPEHMVSFATETNGEISPTQILQMFLSSSTYPEIHGFLHAKEQGKKSWKKIYFLLRRSGLYFSTKGTSKEPRHLQFFSEFGNSDIYVSLAGKKKHGAPTNYGFCFKPNKAGGPRDLKMLCAEEEQSRTCWVTAIRLLKYGMQLYQNYMHPYQGRSGYSSQSISPMRSISENSRVAMDFSGQKTRVIENPTEALSVAVEEGLAWRKKGCLRLGSHGSPTASSQSSATSMAIHRSQPWFHHKMSREEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMSHGQKIKHFQIIPVEDDGEMFHTLDDGHTRFTDLIQLVEFYQLNKGVLPCKLKHYCARIAL Interacts with the cytoplasmic domain of the autophosphorylated insulin receptor which is then inhibited. The interaction is mediated by the SH2 domain mint grb14_mouse Growth factor receptor-bound protein 14 Grb14 GRB14 adapter protein protein protein mouse Mus musculus Mouse MTTSLQDGQSAAGRAGAQDSPLAVQVCRVAQGKGDAQDPAQVPGLHALSPASDATLRGAIDRRKMKDLDVLEKPPIPNPFPELCCSPLTSVLSAGLFPRANSRKKQVIKVYSEDETSRALEVPSDITARDVCQLLILKNHYVDDNSWTLFEHLSHIGLERTVEDHELPTEVLSHWGVEEDNKLYLRKNYAKYEFFKNPMYFFPEHMVSFAAEMNGDRSPTQILQVFLSSSTYPEIHGFLHAKEQGKKSWKKAYFFLRRSGLYFSTKGTSKEPRHLQLFSEFSTSHVYMSLAGKKKHGAPTPYGFCLKPNKAGGPRDLKMLCAEEEQSRTCWVTAIRLLKDGMQLYQNYMHPYQGRSACNSQSMSPMRSVSENSLVAMDFSGEKSRVIDNPTEALSVAVEEGLAWRKKGCLRLGNHGSPSAPSQSSAVNMALHRSQPWFHHRISRDEAQRLIIRQGPVDGVFLVRDSQSNPRTFVLSMSHGQKIKHYQIIPVEDDGELFHTLDDGHTKFTDLIQLVEFYQLNRGVLPCKLKHYCARMAV mint Interacts with the cytoplasmic domain of the autophosphorylated insulin receptor which is then inhibited. The interaction is mediated by the SH2 domain cngb1_human Cyclic nucleotide-gated cation channel beta-1 CNGB1 CNCG2 CNCG3L CNCG4 RCNC2 Cyclic nucleotide-gated cation channel 4 Cyclic nucleotide-gated cation channel modulatory subunit Glutamic acid-rich protein Cyclic nucleotide-gated cation channel gamma Cyclic nucleotide-gated channel beta-1 protein protein human Homo sapiens Human MLGWVQRVLPQPPGTPRKTKMQEEEEVEPEPEMEAEVEPEPNPEEAETESESMPPEESFKEEEVAVADPSPQETKEAALTSTISLRAQGAEISEMNSPSRRVLTWLMKGVEKVIPQPVHSITEDPAQILGHGSTGDTGCTDEPNEALEAQDTRPGLRLLLWLEQNLERVLPQPPKSSEVWRDEPAVATGAASDPAPPGRPQEMGPKLQARETPSLPTPIPLQPKEEPKEAPAPEPQPGSQAQTSSLPPTRDPARLVAWVLHRLEMALPQPVLHGKIGEQEPDSPGICDVQTISILPGGQVEPDLVLEEVEPPWEDAHQDVSTSPQGTEVVPAYEEENKAVEKMPRELSRIEEEKEDEEEEEEEEEEEEEEEVTEVLLDSCVVSQVGVGQSEEDGTRPQSTSDQKLWEEVGEEAKKEAEEKAKEEAEEVAEEEAEKEPQDWAETKEEPEAEAEAASSGVPATKQHPEVQVEDTDADSCPLMAEENPPSTVLPPPSPAKSDTLIVPSSASGTHRKKLPSEDDEAEELKALSPAESPVVAWSDPTTPKDTDGQDRAASTASTNSAIINDRLQELVKLFKERTEKVKEKLIDPDVTSDEESPKPSPAKKAPEPAPDTKPAEAEPVEEEHYCDMLCCKFKHRPWKKYQFPQSIDPLTNLMYVLWLFFVVMAWNWNCWLIPVRWAFPYQTPDNIHHWLLMDYLCDLIYFLDITVFQTRLQFVRGGDIITDKKDMRNNYLKSRRFKMDLLSLLPLDFLYLKVGVNPLLRLPRCLKYMAFFEFNSRLESILSKAYVYRVIRTTAYLLYSLHLNSCLYYWASAYQGLGSTHWVYDGVGNSYIRCYYFAVKTLITIGGLPDPKTLFEIVFQLLNYFTGVFAFSVMIGQMRDVVGAATAGQTYYRSCMDSTVKYMNFYKIPKSVQNRVKTWYEYTWHSQGMLDESELMVQLPDKMRLDLAIDVNYNIVSKVALFQGCDRQMIFDMLKRLRSVVYLPNDYVCKKGEIGREMYIIQAGQVQVLGGPDGKSVLVTLKAGSVFGEISLLAVGGGNRRTANVVAHGFTNLFILDKKDLNEILVHYPESQKLLRKKARRMLRSNNKPKEEKSVLILPPRAGTPKLFNAALAMTGKMGGKGAKGGKLAHLRARLKELAALEAAAKQQELVEQAKSSQDVKGEEGSAAPDQHTHPKEAATDPPAPRTPPEPPGSPPSSPPPASLGRPEGEEEGPAEPEEHSVRICMSPGPEPGEQILSVKMPEEREEKAE mint cnga1_rat cGMP-gated cation channel alpha-1 Cnga1 Cncg Cncg1 Cyclic nucleotide-gated cation channel 1 Cyclic nucleotide-gated channel alpha-1 Cyclic nucleotide-gated channel, photoreceptor Rod photoreceptor cGMP-gated channel subunit alpha protein protein rat Rattus norvegicus (Rat) Rat MKTNIINTWHSFVNIPNVVVPAIEKEIRRMENGACSSFSDNDNGSLSEESENEDSLFRSNSYRRRGPSQREHYLPGTMALFNVNNSSNKDQDPKEKKKKKKEKKSKADDKKESKKDPEKKKKKEKEKEKKKEEKPKEKKEEEKKEVVVIDPSGNMYYNWLFCITLPVMYNWTMIIARACFDELQSDYLEYWLIFDYVSDVVYLADMFVRTRTGYLEQGLLVKDELKLIEKYKANLQFKLDVLSVIPTDLLYFKFGWNYPEIRLNRLLRISRMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVYYSISKAIGFGNDTWVYPDVNDPEFGRLARKYVYSLYWSTLTLTTIGETPPPVLDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQSRVDAIKQYMNFRNVSKDMEKRVIKWFDYLWTNKKTVDEREVLRYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGRQILMKDGLLDINIANLGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVEKFLKPLIETEFSALEEPGGESEPTESLQG mint grb14_rat Growth factor receptor-bound protein 14 Grb14 GRB14 adapter protein protein protein rat Rattus norvegicus (Rat) Rat MTTSLQDGQSAAGRAGAQDSPLAVQVCRVAQGKGDAQDPAQVPGLHALSPASDATRRGAMDRRKAKDLEVQETPSIPNPFPELCCSPLTSVLSAGLFPRSNSRKKQVIKVYSEDETSRALEVPSDVTARDVCQLLILKNHYVDDNSWTLFEHLSHTGVERTVEDHELLTEVLSHWVMEEDNKLYLRKNYAKYEFFKNPMYFFPEHMVSFATEMNGDRSLTQIPQVFLSSNTYPEIHGFLHAKEQGKKSWKKAYFFLRRSGLYFSTKGTSKEPRHLQFFSEFSTSNVYMSLAGKKKHGAPTPYGFCFKPTKAGGPRDLKMLCAEEDQSRMCWVTAIRLLKYGMQLYQNYMHPSQARSACSSQSVSPMRSVSENSLVAMDFSGQKTRVIDNPTEALSVAVEEGLAWRKKGCLRLGNHGSPTAPSQSSAVNMALHRSQPWFHHRISRDEAQQLITRQGPVDGVFLVRDSQSNPRTFVLSMSHGQKIKHFQIIPVEDDGEVFHTLDDGHTKFTDLIQLVEFYQLNKGVLPCKLKHYCARMAV Interacts with the cytoplasmic domain of the autophosphorylated insulin receptor which is then inhibited. The interaction is mediated by the SH2 domain mint cnga1-grb14-2 998233 cnga1_human CNGA1 998237 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false grb14_bovin Grb14 998238 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f5b domino mint grb14-cnga1 998233 cnga1_human CNGA1 998237 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false grb14_bovin Grb14 998238 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f5a domino mint cnga1-grb14-3 998233 grb14_mouse Grb14 998239 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cnga1_human CNGA1 998237 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false homomint mint sf1e sf1f grb14-cnga1-1 998233 grb14_mouse Grb14 998239 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cnga1_human CNGA1 998237 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false homomint mint sf1g sf1h grb14-cngb1 998233 grb14_bovin Grb14 998238 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cngb1_human CNGB1 998240 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false mint sf1i sf1j cnga1-grb14-4 998234 cnga1_human CNGA1 998237 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false grb14_bovin Grb14 998238 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false domino mint f5c f5d cngb1-grb14 998234 cngb1_human CNGB1 998240 predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false grb14_bovin Grb14 998238 predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mint sf1k sf1l cnga1-grb14 998235 cnga1_rat CNGA1 998241 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level grb14_rat Grb14 998242 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f1a f1b mint cnga1-grb14-1 998236 cnga1_human CNGA1 998237 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell grb14_bovin Grb14 998238 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f3e domino mint