MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint schofield-2010-1 Cell cycle coordination and regulation of bacterial chromosome segregation dynamics by polarly localized proteins. strain na1000 / cb15 Caulobacter crescentus anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Schofield WB., Lim HC., Jacobs-Wagner C. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation schofiel-2010-1 Cell cycle coordination and regulation of bacterial chromosome segregation dynamics by polarly localized proteins. strain na1000 / cb15 Caulobacter crescentus fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Schofield WB., Lim HC., Jacobs-Wagner C. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation para_cauvn Chromosome partitioning protein ParA parA CCNA_03869 protein protein strain na1000 / cb15 Caulobacter crescentus MSANPLRVLAIANQKGGVGKTTTAINLGTALAACGERVLLIDADPQGNCSTGLGIGRTQRRTTLYDVLMGEAPVVDAAVKTELPGLDVIPADADLSGVEIELGQTARRSYRLRDALEAIRANGPYTYVLIDCPPSLNVLTVNAMTAADAVFVPLQCEFFALEGLTQLMRTIERVRGSLNPRLEIQGVVLTMYDRRNSLSEQVAKDVRAHFGDKVYDAVIPRNVRVSEAPSFGKPVLLYDLKCAGSQAYLKLAREVISRERDRQAKAA mint a0a0h3c899_cauvn tipN CCNA_01552 protein protein strain na1000 / cb15 Caulobacter crescentus MKPKKRQPLDFSATPTEIPPEEPKTAPELPESASFVAPDAEPSFAEPLTLSDAAPDDLAVPTPTSVRSRRRREAETARFAEPDMKVANSLAATPQPPAPILEPSAPSAPPARSETREAALDLRGSVSASAASLEAEVVPRRMSGVLFWTLATAVAALWALAPIAFALGYARGVPAFKIEGFALMVFAGLAIGPALLTLLGAYMLRQANGISDELRRNRTLTDRLVTPAALAAAGATNAVDAMRQGVDEAAAAAERAREHIISLRKALAEETARLAEAAAESARMANQLAQGLSHERSAMETLSQSLDARSTAVVDAIGSQARMVAEASDLAETQLREAEAALAARAADLAAAAAEASDAARVGAEDLSRQIARLETAGVGVGDQVASVEKTLAAQRAALVEISQALRSEQEDFAAEAETRTAQLTEFVAYTRVGATELSDTAAMGAEILRGLISAAADQFREMADGAKSQRDTLAEEAKKTLETIGDVAENQRTLLEEELKAAMEAMAEAALKAGESVEARVEAARSRVDQLNEIAFAAGQKADAVFESRMEEARDIIEHSAQMVEQAGARTSQKLQDSVQTARSTLDELEVMLAEIGRRTADLPAEALQKAGEVRIAIEQGVEHLMNAVRRTAEETAAIDQAFQERVRRNYEMLSEAAGAVTASGISTVAARATPAAPPPSRSRAAPPPSALPTVEFDDEDEPPSDRRRLRLTPTATDQEFRSVFEQASARKQTGTPPTEAEADGNWSWRGLLSGIESSSPGDAGLGEKLAAEITAMGIDPHALLPRGRIDEIAAALQTRDGEGAREVVKRLAPAAIRRLVRRLFSDATLKGNTERFLKRYAGMIDEAAGQDREGFLLAALLSSDAGRAYLLLDAASGDLA parb_cauvn Chromosome-partitioning protein ParB parB CCNA_03868 protein protein strain na1000 / cb15 Caulobacter crescentus MESVVVGEPGMSEGRRGLGRGLSALLGEVDAAPAQAPGEQLGGSREAPIEILQRNPDQPRRTFREEDLEDLSNSIREKGVLQPILVRPSPDTAGEYQIVAGERRWRAAQRAGLKTVPIMVRELDDLAVLEIGIIENVQRADLNVLEEALSYKVLMEKFERTQENIAQTIGKSRSHVANTMRLLALPDEVQSYLVSGELTAGHARAIAAAADPVALAKQIIEGGLSVRETEALARKAPNLSAGKSKGGRPPRVKDTDTQALESDLSSVLGLDVSIDHRGSTGTLTITYATLEQLDDLCNRLTRGI mint tipn-para 995926 para_caucn parA 995928 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false b8h5u9_caucn tipN 995929 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f3a mint tipn-para-1 995926 para_caucn parA 995928 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell B8GW31:p.Gly16Val mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false b8h5u9_caucn tipN 995929 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f4g mint para-tipn 995927 para_caucn parA 995928 tag fluorescence tag visualisation by fluorescence tag fluorescence electron acceptor electron acceptor neutral component neutral component over-expressed over expressed level over-expressed living cell living cell yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false b8h5u9_caucn tipN 995929 tag fluorescence tag visualisation by fluorescence tag fluorescence electron donor electron donor neutral component neutral component over-expressed over expressed level over-expressed living cell living cell cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false proximity proximity close-contact colocalization neighbourhood interaction false false false f3b mint para-parb-2 995927 para_caucn parA 995928 tag fluorescence tag visualisation by fluorescence tag fluorescence electron acceptor electron acceptor neutral component neutral component over-expressed over expressed level over-expressed living cell living cell yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false parb_caucn parB 995930 tag fluorescence tag visualisation by fluorescence tag fluorescence electron donor electron donor neutral component neutral component over-expressed over expressed level over-expressed living cell living cell cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false proximity proximity close-contact colocalization neighbourhood interaction false false false sf5a mint