IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ fulzele-2010-2 Insulin receptor signaling in osteoblasts regulates postnatal bone acquisition and body composition. mouse-osteoblast Mouse osteoblast osteoblast Osteoblast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fulzele K., Riddle RC., DiGirolamo DJ., Cao X., Wan C., Chen D., Faugere MC., Aja S., Hussain MA., Bruning JC., Clemens TL. tclemen5@jhmi.edu Cell (0092-8674) 2010 Only protein-protein interactions imex curation fulzele-2010-1 Insulin receptor signaling in osteoblasts regulates postnatal bone acquisition and body composition. mouse-osteoblast Mouse osteoblast osteoblast Osteoblast ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Fulzele K., Riddle RC., DiGirolamo DJ., Cao X., Wan C., Chen D., Faugere MC., Aja S., Hussain MA., Bruning JC., Clemens TL. tclemen5@jhmi.edu Cell (0092-8674) 2010 Only protein-protein interactions imex curation runx2_mouse Runt-related transcription factor 2 Runx2 Aml3 Cbfa1 Osf2 Pebp2a Core-binding factor subunit alpha-1 Acute myeloid leukemia 3 protein Oncogene AML-3 Polyomavirus enhancer-binding protein 2 alpha A subunit SL3-3 enhancer factor 1 alpha A subunit SL3/AKV core-binding factor alpha A subunit Osteoblast-specific transcription factor 2 protein protein mouse Mus musculus Mouse MLHSPHKQPQNHKCGANFLQEDCKKALAFKWLISAGHYQPPRPTESVSALTTVHAGIFKAASSIYNRGHKFYLEKKGGTMASNSLFSAVTPCQQSFFWDPSTSRRFSPPSSSLQPGKMSDVSPVVAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQEAAAAAAAAAAAAAAAAAAVPRLRPPHDNRTMVEIIADHPAELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGEVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSSLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQTSSTPYLYYGTSSASYQFPMVPGGDRSPSRMVPPCTTTSNGSTLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY twst2_mouse Twist-related protein 2 Twist2 Dermo1 Dermis-expressed protein 1 protein protein mouse Mus musculus Mouse MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAYSVWRMEGAWSMSASH ostcn_mouse_gene Mouse osteocalcin gene gene gene mouse Mus musculus Mouse runx2-twist2 975458 n/a 975460 unspecified role unspecified role bait bait n/a 975461 unspecified role unspecified role prey prey physical association physical association false false false Interaction decreases in IR-/- cells. Fig. 1O runx2-twist2-1 975458 n/a 975461 unspecified role unspecified role bait bait n/a 975460 unspecified role unspecified role prey prey physical association physical association false false false Interaction decreases in IR-/- cells. Fig. 1O runx2-ostn_gene Binding of Runx2 to the OSTCN gene 975459 n/a 975460 unspecified role unspecified role bait bait n/a 975462 unspecified role unspecified role prey prey association association false false false Fig. 1I, 1J Runx2 binds to the osteocalcin promoter Insulin