IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ wang-2010-1 PML/RARalpha targets promoter regions containing PU.1 consensus and RARE half sites in acute promyelocytic leukemia. human-u937_pr9 Homo sapiens U937-PR9 lymphoma cells expressing zinc-inducible PML-RAR alpha u937_pr9 U937-PR9 hematopoietic precursor cells expressing zinc-inducible PML-RAR alpha U937-PR9 cells, which are hematopoietic precursor cells carrying the PML-RARa coding sequence under the control of a zinc-inducible promoter. ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Wang K., Wang P., Shi J., Zhu X., He M., Jia X., Yang X., Qiu F., Jin W., Qian M., Fang H., Mi J., Yang X., Xiao H., Minden M., Du Y., Chen Z., Zhang J. Cancer - Interactions investigated in the context of cancer TrEMBL Q15156 (PML-RAR fusion protein)has been used as a reference entry only, as the exact sequence of the fusion protein is not known. Re-chIp assay using ZnSO4-treated PR9 cells. jizhang@sibs.ac.cn Anti-RAR-alpha antibody used. Cancer Cell (1535-6108) 2010 Only protein-protein interactions 7 imex curation wang-2010-3 PML/RARalpha targets promoter regions containing PU.1 consensus and RARE half sites in acute promyelocytic leukemia. human-u937_pr9 Homo sapiens U937-PR9 lymphoma cells expressing zinc-inducible PML-RAR alpha u937_pr9 U937-PR9 hematopoietic precursor cells expressing zinc-inducible PML-RAR alpha U937-PR9 cells, which are hematopoietic precursor cells carrying the PML-RARa coding sequence under the control of a zinc-inducible promoter. ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Wang K., Wang P., Shi J., Zhu X., He M., Jia X., Yang X., Qiu F., Jin W., Qian M., Fang H., Mi J., Yang X., Xiao H., Minden M., Du Y., Chen Z., Zhang J. Cancer - Interactions investigated in the context of cancer TrEMBL Q15156 (PML-RAR fusion protein)has been used as a reference entry only, as the exact sequence of the fusion protein is not known. Re-chIp assay using ZnSO4-treated PR9 cells. jizhang@sibs.ac.cn Anti-RAR-alpha antibody used. Cancer Cell (1535-6108) 2010 Only protein-protein interactions 7 imex curation wang-2010-2 PML/RARalpha targets promoter regions containing PU.1 consensus and RARE half sites in acute promyelocytic leukemia. human-u937_pr9 Homo sapiens U937-PR9 lymphoma cells expressing zinc-inducible PML-RAR alpha u937_pr9 U937-PR9 hematopoietic precursor cells expressing zinc-inducible PML-RAR alpha U937-PR9 cells, which are hematopoietic precursor cells carrying the PML-RARa coding sequence under the control of a zinc-inducible promoter. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang K., Wang P., Shi J., Zhu X., He M., Jia X., Yang X., Qiu F., Jin W., Qian M., Fang H., Mi J., Yang X., Xiao H., Minden M., Du Y., Chen Z., Zhang J. Cancer - Interactions investigated in the context of cancer TrEMBL Q15156 (PML-RAR fusion protein)has been used as a reference entry only, as the exact sequence of the fusion protein is not known. Re-chIp assay using ZnSO4-treated PR9 cells. jizhang@sibs.ac.cn Anti-RAR-alpha antibody used. Cancer Cell (1535-6108) 2010 Only protein-protein interactions 7 imex curation wang-2010-4 PML/RARalpha targets promoter regions containing PU.1 consensus and RARE half sites in acute promyelocytic leukemia. human-nb4 Human NB4 APL cell line nb4 NB4 human acute promyelocytic leukemia cells Human acute promyelocytic leukemia established from the bone marrow of a 23- year-old woman with acute promyelocytic leukemia (APL = AML FAB M3) in second relapse in 1989; patented cell line; cells carry the t(15;17) PML-RARA fusion gene confirmed as human with IEF of AST, MDH anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang K., Wang P., Shi J., Zhu X., He M., Jia X., Yang X., Qiu F., Jin W., Qian M., Fang H., Mi J., Yang X., Xiao H., Minden M., Du Y., Chen Z., Zhang J. Cancer - Interactions investigated in the context of cancer TrEMBL Q15156 (PML-RAR fusion protein)has been used as a reference entry only, as the exact sequence of the fusion protein is not known. Re-chIp assay using ZnSO4-treated PR9 cells. jizhang@sibs.ac.cn Anti-RAR-alpha antibody used. Cancer Cell (1535-6108) 2010 Only protein-protein interactions 7 imex curation wang-2010-5 PML/RARalpha targets promoter regions containing PU.1 consensus and RARE half sites in acute promyelocytic leukemia. human-nb4 Human NB4 APL cell line nb4 NB4 human acute promyelocytic leukemia cells Human acute promyelocytic leukemia established from the bone marrow of a 23- year-old woman with acute promyelocytic leukemia (APL = AML FAB M3) in second relapse in 1989; patented cell line; cells carry the t(15;17) PML-RARA fusion gene confirmed as human with IEF of AST, MDH confocal microscopy confocal microscopy immunostaining immunostaining Wang K., Wang P., Shi J., Zhu X., He M., Jia X., Yang X., Qiu F., Jin W., Qian M., Fang H., Mi J., Yang X., Xiao H., Minden M., Du Y., Chen Z., Zhang J. Cancer - Interactions investigated in the context of cancer TrEMBL Q15156 (PML-RAR fusion protein)has been used as a reference entry only, as the exact sequence of the fusion protein is not known. Re-chIp assay using ZnSO4-treated PR9 cells. jizhang@sibs.ac.cn Anti-RAR-alpha antibody used. Cancer Cell (1535-6108) 2010 Only protein-protein interactions 7 imex curation wang-2010-6 PML/RARalpha targets promoter regions containing PU.1 consensus and RARE half sites in acute promyelocytic leukemia. human-apl_blasts Homo sapiens APL (Acute Promyelocytic Leukaemia )blasts apl_blast cells APL (Acute Promyelocytic Leukaemia )blasts Bone marrow cells with > 85% abnormal blasts and promyelocytic cells. confocal microscopy confocal microscopy immunostaining immunostaining Wang K., Wang P., Shi J., Zhu X., He M., Jia X., Yang X., Qiu F., Jin W., Qian M., Fang H., Mi J., Yang X., Xiao H., Minden M., Du Y., Chen Z., Zhang J. Cancer - Interactions investigated in the context of cancer TrEMBL Q15156 (PML-RAR fusion protein)has been used as a reference entry only, as the exact sequence of the fusion protein is not known. Re-chIp assay using ZnSO4-treated PR9 cells. jizhang@sibs.ac.cn Anti-RAR-alpha antibody used. Cancer Cell (1535-6108) 2010 Only protein-protein interactions 7 imex curation q15156_human PML-RAR protein protein human Homo sapiens Human MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKAIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP ab1ip_human_gene Human PU.1-RAREh site gene gene human Homo sapiens Human spi1_human Transcription factor PU.1 SPI1 31 kDa-transforming protein protein protein human Homo sapiens Human MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH csf3r_human_gene PU.1-RAREh site gene gene human Homo sapiens Human fes_human_gene Human PU.1-RAREh site gene gene human Homo sapiens Human fril_human_gene Human PU.1-RAREh site gene gene human Homo sapiens Human psb10_human_gene Proteasome subunit beta type-10 gene gene human Homo sapiens Human tnr18_human_gene Human PU.1-RAREh site gene gene human Homo sapiens Human hck_human_gene PU.1-RAREh site gene gene human Homo sapiens Human crtc2_human CREB-regulated transcription coactivator 2 TORC2 Transducer of regulated cAMP response element-binding protein 2 CRTC2 protein protein human Homo sapiens Human MATSGANGPGSATASASNPRKFSEKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLAYTRSSHYGGSLPNVNQIGSGLAEFQSPLHSPLDSSRSTRHHGLVERVQRDPRRMVSPLRRYTRHIDSSPYSPAYLSPPPESSWRRTMAWGNFPAEKGQLFRLPSALNRTSSDSALHTSVMNPSPQDTYPGPTPPSILPSRRGGILDGEMDPKVPAIEENLLDDKHLLKPWDAKKLSSSSSRPRSCEVPGINIFPSPDQPANVPVLPPAMNTGGSLPDLTNLHFPPPLPTPLDPEETAYPSLSGGNSTSNLTHTMTHLGISRGMGLGPGYDAPGLHSPLSHPSLQSSLSNPNLQASLSSPQPQLQGSHSHPSLPASSLARHVLPTTSLGHPSLSAPALSSSSSSSSTSSPVLGAPSYPASTPGASPHHRRVPLSPLSLLAGPADARRSQQQLPKQFSPTMSPTLSSITQGVPLDTSKLSTDQRLPPYPYSSPSLVLPTQPHTPKSLQQPGLPSQSCSVQSSGGQPPGRQSHYGTPYPPGPSGHGQQSYHRPMSDFNLGNLEQFSMESPSASLVLDPPGFSEGPGFLGGEGPMGGPQDPHTFNHQNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALAGVPGFEVSAAGLELGLGLEDELRMEPLGLEGLNMLSDPCALLPDPAVEESFRSDRLQ meis1_human Homeobox protein Meis1 MEIS1 protein protein human Homo sapiens Human MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM creb1_human Cyclic AMP-responsive element-binding protein 1 CREB1 protein protein human Homo sapiens Human MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD rarb_human_gene Human RARBeta gene gene gene human Homo sapiens Human spi1_human_gene Human Spi1 (PU.1) gene gene gene human Homo sapiens Human rxra_human Retinoic acid receptor RXR-alpha RXRA NR2B1 Retinoid X receptor alpha Nuclear receptor subfamily 2 group B member 1 protein protein human Homo sapiens Human MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT ab1ip 886518 n/a 886524 unspecified role unspecified role prey prey n/a 886525 unspecified role unspecified role prey prey n/a 886526 unspecified role unspecified role bait bait association association false false false Validation of the co-presence of PML/RARa and PU.1 on the same PU.1-RAREh regions. Regions immunoprecipitated with the first antibody were re-immunoprecipitated with the second antibody indicating the binding of PU.1 and PML/RARa to the same DNA. Fig 3B ab1ip-1 886518 n/a 886524 unspecified role unspecified role bait bait n/a 886526 unspecified role unspecified role prey prey n/a 886525 unspecified role unspecified role prey prey association association false false false Validation of the co-presence of PML/RARa and PU.1 on the same PU.1-RAREh regions. Regions immunoprecipitated with the first antibody were re-immunoprecipitated with the second antibody indicating the binding of PU.1 and PML/RARa to the same DNA. Fig 3B csf3r 886518 n/a 886524 unspecified role unspecified role bait bait n/a 886527 unspecified role unspecified role prey prey n/a 886526 unspecified role unspecified role prey prey association association false false false Validation of the co-presence of PML/RARa and PU.1 on the same PU.1-RAREh regions. Regions immunoprecipitated with the first antibody were re-immunoprecipitated with the second antibody indicating the binding of PU.1 and PML/RARa to the same DNA. Fig 3B csf3r-1 886518 n/a 886524 unspecified role unspecified role prey prey n/a 886526 unspecified role unspecified role bait bait n/a 886527 unspecified role unspecified role prey prey association association false false false Validation of the co-presence of PML/RARa and PU.1 on the same PU.1-RAREh regions. Regions immunoprecipitated with the first antibody were re-immunoprecipitated with the second antibody indicating the binding of PU.1 and PML/RARa to the same DNA. Fig 3B fes 886518 n/a 886524 unspecified role unspecified role prey prey n/a 886528 unspecified role unspecified role prey prey n/a 886526 unspecified role unspecified role bait bait association association false false false Validation of the co-presence of PML/RARa and PU.1 on the same PU.1-RAREh regions. Regions immunoprecipitated with the first antibody were re-immunoprecipitated with the second antibody indicating the binding of PU.1 and PML/RARa to the same DNA. Fig 3B fes-1 886518 n/a 886524 unspecified role unspecified role bait bait n/a 886526 unspecified role unspecified role prey prey n/a 886528 unspecified role unspecified role prey prey association association false false false Validation of the co-presence of PML/RARa and PU.1 on the same PU.1-RAREh regions. Regions immunoprecipitated with the first antibody were re-immunoprecipitated with the second antibody indicating the binding of PU.1 and PML/RARa to the same DNA. Fig 3B fril 886518 n/a 886524 unspecified role unspecified role bait bait n/a 886529 unspecified role unspecified role prey prey n/a 886526 unspecified role unspecified role prey prey association association false false false Validation of the co-presence of PML/RARa and PU.1 on the same PU.1-RAREh regions. Regions immunoprecipitated with the first antibody were re-immunoprecipitated with the second antibody indicating the binding of PU.1 and PML/RARa to the same DNA. Fig 3B fril-1 886518 n/a 886524 unspecified role unspecified role prey prey n/a 886529 unspecified role unspecified role prey prey n/a 886526 unspecified role unspecified role bait bait association association false false false Validation of the co-presence of PML/RARa and PU.1 on the same PU.1-RAREh regions. Regions immunoprecipitated with the first antibody were re-immunoprecipitated with the second antibody indicating the binding of PU.1 and PML/RARa to the same DNA. Fig 3B psb10 886518 n/a 886524 unspecified role unspecified role prey prey n/a 886530 unspecified role unspecified role prey prey n/a 886526 unspecified role unspecified role bait bait association association false false false Validation of the co-presence of PML/RARa and PU.1 on the same PU.1-RAREh regions. Regions immunoprecipitated with the first antibody were re-immunoprecipitated with the second antibody indicating the binding of PU.1 and PML/RARa to the same DNA. Fig 3B psb10-1 886518 n/a 886524 unspecified role unspecified role bait bait n/a 886526 unspecified role unspecified role prey prey n/a 886530 unspecified role unspecified role prey prey association association false false false Validation of the co-presence of PML/RARa and PU.1 on the same PU.1-RAREh regions. Regions immunoprecipitated with the first antibody were re-immunoprecipitated with the second antibody indicating the binding of PU.1 and PML/RARa to the same DNA. Fig 3B tnr1b 886518 n/a 886524 unspecified role unspecified role bait bait n/a 886531 unspecified role unspecified role prey prey n/a 886526 unspecified role unspecified role prey prey association association false false false Validation of the co-presence of PML/RARa and PU.1 on the same PU.1-RAREh regions. Regions immunoprecipitated with the first antibody were re-immunoprecipitated with the second antibody indicating the binding of PU.1 and PML/RARa to the same DNA. Fig 3B tnr1b-1 886518 n/a 886524 unspecified role unspecified role prey prey n/a 886531 unspecified role unspecified role prey prey n/a 886526 unspecified role unspecified role bait bait association association false false false Validation of the co-presence of PML/RARa and PU.1 on the same PU.1-RAREh regions. Regions immunoprecipitated with the first antibody were re-immunoprecipitated with the second antibody indicating the binding of PU.1 and PML/RARa to the same DNA. Fig 3B hck 886518 n/a 886524 unspecified role unspecified role prey prey n/a 886532 unspecified role unspecified role prey prey n/a 886526 unspecified role unspecified role bait bait association association false false false Validation of the co-presence of PML/RARa and PU.1 on the same PU.1-RAREh regions. Regions immunoprecipitated with the first antibody were re-immunoprecipitated with the second antibody indicating the binding of PU.1 and PML/RARa to the same DNA. Fig 3B hck-5 886518 n/a 886524 unspecified role unspecified role bait bait n/a 886532 unspecified role unspecified role prey prey n/a 886526 unspecified role unspecified role prey prey association association false false false Validation of the co-presence of PML/RARa and PU.1 on the same PU.1-RAREh regions. Regions immunoprecipitated with the first antibody were re-immunoprecipitated with the second antibody indicating the binding of PU.1 and PML/RARa to the same DNA. Fig 3B meis1-creb_torc 886518 n/a 886533 unspecified role unspecified role prey prey n/a 886534 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 886535 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 5H. The MEIS1/CREB association depends on TORC. hck-rara 886519 n/a 886524 unspecified role unspecified role bait bait n/a 886532 unspecified role unspecified role prey prey association association false false false RXR was present in some, but not all, of the tested ChIP regions. Fig 5F fril-rara 886519 n/a 886524 unspecified role unspecified role bait bait n/a 886529 unspecified role unspecified role prey prey association association false false false RXR was present in some, but not all, of the tested ChIP regions. Fig 5F. rarb-rara 886519 n/a 886524 unspecified role unspecified role bait bait n/a 886536 unspecified role unspecified role prey prey association association false false false RXR was present in some, but not all, of the tested ChIP regions. Fig 5F. spi1-rara 886519 n/a 886524 unspecified role unspecified role bait bait n/a 886537 unspecified role unspecified role prey prey association association false false false RXR was present in some, but not all, of the tested ChIP regions. Fig 5F. hck-rxra 886519 n/a 886538 unspecified role unspecified role bait bait n/a 886532 unspecified role unspecified role prey prey association association false false false RXR was present in some, but not all, of the tested ChIP regions. Fig 5F fril-rxra 886519 n/a 886529 unspecified role unspecified role prey prey n/a 886538 unspecified role unspecified role bait bait association association false false false RXR was present in some, but not all, of the tested ChIP regions. Fig 5F. rarb-rxra-1 886519 n/a 886536 unspecified role unspecified role prey prey n/a 886538 unspecified role unspecified role bait bait association association false false false RXR was present in some, but not all, of the tested ChIP regions. Fig 5F. rara-pml-pu1 886520 n/a 886524 unspecified role unspecified role prey prey n/a 886526 unspecified role unspecified role bait bait physical association physical association false false false PML/RARa was specifically detected in immunoprecipitates obtained with the anti-PU.1 antibody, suggesting that an interaction between PML/RARa and PU.1 occurred in vivo. Fig 3D pml-rara-pu1 886520 n/a 886524 unspecified role unspecified role bait bait n/a 886526 unspecified role unspecified role prey prey physical association physical association false false false PML/RARa was specifically detected in immunoprecipitates obtained with the anti-PU.1 antibody, suggesting that an interaction between PML/RARa and PU.1 occurred in vivo. Fig 3D pml-spi1 886521 n/a 886524 unspecified role unspecified role bait bait n/a 886526 unspecified role unspecified role prey prey physical association physical association false false false PML/RARa was immunoprecipitated by the anti-PU.1 antibody and vice versa, demonstrating that PML/RARa interacts with PU.1 in NB4 cells - (a cell line expressing the PML/RARa fusion protein). Fig 6B spi1-rara-1 886521 n/a 886524 unspecified role unspecified role prey prey n/a 886526 unspecified role unspecified role bait bait physical association physical association false false false PML/RARa was immunoprecipitated by the anti-PU.1 antibody and vice versa, demonstrating that PML/RARa interacts with PU.1 in NB4 cells - (a cell line expressing the PML/RARa fusion protein). Fig 6B pml-spi1-1 886522 n/a 886524 unspecified role unspecified role neutral component neutral component n/a 886526 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false PU.1 and PML/RARa colocalized on microspeckles. Fig 6C pml-spi1-2 886523 n/a 886524 unspecified role unspecified role neutral component neutral component n/a 886526 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false PU.1 and PML/RARa colocalized on microspeckles. Fig 6C, S3.