MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint williams-2010-1 gammaH2A binds Brc1 to maintain genome integrity during S-phase. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Williams JS., Williams RS., Dovey CL., Guenther G., Tainer JA., Russell P. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation williams-2010-2 gammaH2A binds Brc1 to maintain genome integrity during S-phase. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Williams JS., Williams RS., Dovey CL., Guenther G., Tainer JA., Russell P. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation williams-2010-3 gammaH2A binds Brc1 to maintain genome integrity during S-phase. in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Williams JS., Williams RS., Dovey CL., Guenther G., Tainer JA., Russell P. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation williams-2010-4 gammaH2A binds Brc1 to maintain genome integrity during S-phase. in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Williams JS., Williams RS., Dovey CL., Guenther G., Tainer JA., Russell P. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation h2a1_schpo Histone H2A-alpha hta1 SPCC622.08c H2A.1 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSGGKSGGKAAVAKSAQSRSAKAGLAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGHVTIAQGGVVPNINAHLLPKTSGRTGKPSQEL mint Core component of nucleosome which plays a central role in DNA double strand break (DSB) repair. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling brc1_schpo BRCT-containing protein 1 brc1 SPBC582.05c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEKIKLLNVKTPNHYTIIFKVVAYYSALQPNQNELRKKELFIKNDGKALSFPYDWKLATHVICDDFSSPNVQEGSKRSLRLAKTNWIRDCVDKNTLLNYSFYSCNPYLLFKGICASSCQIDSYQSSLIDDALETFGGRFSKGLMKSMTHLFTYSGMGAKCKKVLDKPSLSIKLIHPQWLLDCLQFGQLIDQDPYLFPNPSYKKNDSSISKAEPTSLFRNVLHGKRIYFSNDLNLPTNFRHSLQKFSVGIGAKIAESINDCDIFIGLKRDTIEFNLASNKNTTIGTISWLLNLFVLGSWKSPLLNALHYPFPSVGFLKDQMVAVTNYTDAARIYLEKLLLACGATYTKDLKPTNTLLIAASSYGQKYGAAKVWNIPTVHHSWLYSSFKNLSSQAFTDFPVPLDDSYMDFIFPCPLNVEKGSFEDTLKSSLTKGNSEVLLDDLSDPSVSSIKGNKTNEELEKEFKSTSDNFGKHIILTSSFSNQSADKGSSLAAEDDRNDEGSTITGVNRELQDEGRLEIDAKSSKTNTPPSPLLVGTPSKESLKEASSDDELPVLATKLVDNVIKEKSPLSLTPKVVVPSHKETYTDEKKLIDELDRVNPLNSSQLLRSKRKSAATALSMLQNVIMPDVLAFEREKKRRQTHRSVSSGEVSRESSESRNTNAKASKRVYITFTGYDKKPSIDNLKKLDMSITSNPSKCTHLIAPRILRTSKFLCSIPYGPCVVTMDWINSCLKTHEIVDEEPYLLNDPEKELELGCTLESALKRARAQGPSLLEDYVVYLTSKTVAPENVPAVISIVKSNGGVCSTLNVYNKRLARHLEDGNVVLITCNEDSHIWTNFLDNASQNKTIFLQNYDWLIKTVLRQEIDVNDRIADEFARAV mint Required for mitotic fidelity, specifically in the G2 phase of the cell cycle. Plays a role in chromatin organization brc1-hta1 918734 h2a1_schpo gamma H2A/X 918738 peptide synthesis peptide synthesis unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm brc1_schpo brc1 918739 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false domino mint st2 f2c f3a f3b f3d f3e f4a f4d f7a brc1-hta1-1 918735 brc1_schpo brc1 918739 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q10337:p.Thr672Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false h2a1_schpo gamma H2A/X 918738 peptide synthesis peptide synthesis unspecified role unspecified role neutral component neutral component purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false direct interaction direct interaction false false false f2a domino mint brc1-hta1-2 918736 brc1_schpo brc1 918739 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Q10337:p.Thr672Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false h2a1_schpo gamma H2A/X 918738 peptide synthesis peptide synthesis unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f2b domino mint brc1-hta1-3 918737 brc1_schpo brc1 918739 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false h2a1_schpo gamma H2A/X 918738 peptide synthesis peptide synthesis unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f2d domino mint