MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint poulsen-2010-1 Stoichiometric protein complex formation and over-expression using the prokaryotic native operon structure. in vitro In vitro bn-page blue native page bn-page predetermined predetermined participant predetermined Poulsen C., Holton S., Geerlof A., Wilmanns M., Song YH. FEBS Lett. (0014-5793) 2010 Only protein-protein interactions imex curation poulsen-2010-2 Stoichiometric protein complex formation and over-expression using the prokaryotic native operon structure. ecoli Escherichia coli (strain K12) pull down pull down predetermined predetermined participant predetermined Poulsen C., Holton S., Geerlof A., Wilmanns M., Song YH. FEBS Lett. (0014-5793) 2010 Only protein-protein interactions imex curation poulsen-2010-3 Stoichiometric protein complex formation and over-expression using the prokaryotic native operon structure. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Poulsen C., Holton S., Geerlof A., Wilmanns M., Song YH. FEBS Lett. (0014-5793) 2010 Only protein-protein interactions imex curation poulsen-2010-4 Stoichiometric protein complex formation and over-expression using the prokaryotic native operon structure. mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) pull down pull down predetermined predetermined participant predetermined Poulsen C., Holton S., Geerlof A., Wilmanns M., Song YH. FEBS Lett. (0014-5793) 2010 Only protein-protein interactions imex curation poulsen-2010-5 Stoichiometric protein complex formation and over-expression using the prokaryotic native operon structure. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Poulsen C., Holton S., Geerlof A., Wilmanns M., Song YH. FEBS Lett. (0014-5793) 2010 Only protein-protein interactions imex curation esxa_myctu 6 kDa early secretory antigenic target esxA esaT6 Rv3875 MTV027.10 ESAT-6 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDATATELNNALQNLARTISEAGQAMASTEGNVTGMFA esxb_myctu ESAT-6-like protein EsxB esxB cfp10 lhp mtsA10 Rv3874 MTV027.09 10 kDa culture filtrate antigen CFP-10 Secreted antigenic protein MTSA-10 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MAEMKTDAATLAQEAGNFERISGDLKTQIDQVESTAGSLQGQWRGAAGTAAQAAVVRFQEAANKQKQELDEISTNIRQAGVQYSRADEEQQQALSSQMGF esxb_mycle ESAT-6-like protein EsxB esxB MLCB628.13c ML0050 protein protein mycle Mycobacterium leprae (strain TN) MAEMITEAAILTQQAAQFDQIASGLSQERNFVDSIGQSFQNTWEGQAASAALGALGRFDEAMQDQIRQLESIVDKLNRSGGNYTKTDDEANQLLSSKMNF mint esxa_mycle 6 kDa early secretory antigenic target homolog esxA esaT6 esx L45 ESAT-6-like protein L-ESAT MLCB628.12c ML0049 protein protein mycle Mycobacterium leprae (strain TN) MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESYSSVQRRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVMSMFTG mint esxa-esxb-8 871739 esxa_myctu ESAT-6 871744 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.1 esxb_myctu CFP-10 871745 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.1 direct interaction direct interaction false false false mint f2b sf1d esxa-esxb-9 871739 esxb_mycle CFP-10 871746 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.1 esxa_mycle ESAT-6 871747 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.1 direct interaction direct interaction false false false f4b mint esxb-esxa-1 871740 esxb_myctu CFP-10 871745 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.1 esxa_myctu ESAT-6 871744 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.1 physical association physical association false false false f2a mint esxa-esxb-10 871741 esxb_myctu CFP-10 871745 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified esxa_myctu ESAT-6 871744 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f3a mint esxb-esxa-2 871742 esxb_myctu CFP-10 871745 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.1 esxa_myctu ESAT-6 871744 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.1 physical association physical association false false false f2a mint esxa-esxb-11 871743 esxb_myctu CFP-10 871745 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.1 esxa_myctu ESAT-6 871744 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.1 direct interaction direct interaction false false false mint sf1a sf1b