MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint lin-2010b-1 Yeast axial-element protein, Red1, binds SUMO chains to promote meiotic interhomologue recombination and chromosome synapsis. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lin FM., Lai YJ., Shen HJ., Cheng YH., Wang TF. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation lin-2010b-3 Yeast axial-element protein, Red1, binds SUMO chains to promote meiotic interhomologue recombination and chromosome synapsis. yeast Saccharomyces cerevisiae Baker's yeast fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Lin FM., Lai YJ., Shen HJ., Cheng YH., Wang TF. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation lin-2010b-2 Yeast axial-element protein, Red1, binds SUMO chains to promote meiotic interhomologue recombination and chromosome synapsis. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lin FM., Lai YJ., Shen HJ., Cheng YH., Wang TF. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation lin-2010b-4 Yeast axial-element protein, Red1, binds SUMO chains to promote meiotic interhomologue recombination and chromosome synapsis. yeast Saccharomyces cerevisiae Baker's yeast pull down pull down predetermined predetermined participant predetermined Lin FM., Lai YJ., Shen HJ., Cheng YH., Wang TF. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation red1_yeast Protein RED1 RED1 YLR263W L8479.6 Reductional division protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MEGLKKKIFGVCLKNDLAQTRNETKGIHYGLMTLETSKQLQEFLHLLVIKREVIQNFELLFHIINVAVKITDSNLPSDDIWHFILKLRFSSEINIDEDSKVLNYLLETGIAMENPVSWKCLAVISSILSSVPQSKKIITNLIETEHAKKIGQLFDNIQDLQQGNFLVEILSNCFKKSASNSKKVEKIPQLWQSRSKNKFFFENEFYPFSSKNGSLQTCQFLCNNFMSTLSFTGILRQVSYSGSETLKNLRIFKKKDDENSYFIQCIYNKIYLWLDEKAPLEFERKKIRITKNLKNKIQIKLRQPFHECVRTTADKTALLFNKTKGFQLEFEDEKLGETFFHNVNNIPKISEVQNFLVLDYIEEEPENEGEEEEQIGRADEQKEDEEEESLDELSTPMVYPIKSSIPHNHNEKVQLVTPDRSVSIRSDEWDLKSNTEDEEGNVLADLKISSTKETKRQTDYVHIDSEDQSPVVSAQMRKMRRESTKTLEILRQEFKDKDVQNKEDQSEQIQNPFVNTSSLVVGKSCLVNPKEKPNIDQTVVGITELKSNSSIKKRDINILDTIFGQPPSKKQKQFHKKEKKKQQKKLTNFKPIIDVPSQDKRNLRSNAPTKPKSIKVSKLRTDKKVTGEKSSPETAAEKVDDQTVRSNDEQAMSRATKEKCFPDVNEGKEITKDDAKVSLESKKNNETFVDSSVVEKHTPPDKDCNNCNITDILESTTVIDLQSPHGLSAPGQNTFTNKLQEQIYSSINHFSNELVRKISIINQELNKKILKELSEKYQKLFSELQDNFQNDTNEMLKFMGEIKDMMNLPEDQLVHAIRTRKFDNNKR CA1A206F9A274C3F smt3_yeast Ubiquitin-like protein SMT3 SMT3 D9719.15 YDR510W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGATY A2790DE7F315E1A7 zip1_yeast Synaptonemal complex protein ZIP1 ZIP1 D9819.9 YDR285W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNFFRDSSMGFKPRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTSTEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIENDTDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKAPLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQSYASNSDKINEKVGKYKSCLETLQERIATLTSHKNNQETKLKDLRQNHQLYQRRISGFKTSIENLNKTINDLGKNKKEADAELMKKGKEIEYLKRELDDCSGQLSEEKIKNSSLIQEMGKNREEMIKSIENFFSEDKAHHLLQFNKFEERVHDLFEKKLQKHFDVAKDTLNVGLRNTTVELSSNTETMLKQQYEDIKENLEQKMSSSKDEMAKTINELSVTQKGLIMGVQEELLTSSGNIQTALVSEMNNTRQELLDDASQTAKNYASLENLVKAYKAEIVQSNEYEERIKHLESERSTLSSQKNQIISSLGTKEAQYEDLVKKLEAKNIEISQISGKEQSLTEKNENLSNELKKVQDQLEKLNNLNITTKSNYENKISSQNEIVKALVSENDTLKQRIQQLVEIKENEQKDHTTKLEAFQKNNEQLQKLNVEVVQLKAHELELEEQNRHLKNCLEKKETGVEESLSDVKTLKQQVIVLKSEKQDITAEKLELQDNLESLEEVTKNLQQKVQSQKRELEQKIKELEEIKNHKRNEPSKKGTQNFTKPSDSPKKNATTSNLFPNNSAAIHSPMKKCPKVDHISKSRINSSKETSKFNDEFDLSSSSNDDLELTNPSPIQIKPVRGKIKKGSNCMKPPISSRKKLLLVEDEDQSLKISKKRRRK 674F12625CD9DDFD hop1_yeast Meiosis-specific protein HOP1 HOP1 YIL072W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNKQLVKPKTETKTEITTEQSQKLLQTMLTMSFGCLAFLRGLFPDDIFVDQRFVPEKVEKNYNKQNTSQNNSIKIKTLIRGKSAQADLLLDWLEKGVFKSIRLKCLKALSLGIFLEDPTDLLENYIFSFDYDEENNVNINVNLSGNKKGSKNADPENETISLLDSRRMVQQLMRRFIIITQSLEPLPQKKFLTMRLMFNDNVDEDYQPELFKDATFDKRATLKVPTNLDNDAIDVGTLNTKHHKVALSVLSAATSSMEKAGNTNFIRVDPFDLILQQQEENKLEESVPTKPQNFVTSQTTNVLGNLLNSSQASIQPTQFVSNNPVTGICSCECGLEVPKAATVLKTCKSCRKTLHGICYGNFLHSSIEKCFTCIFGPSLDTKWSKFQDLMMIRKVFRFLVRKKKGFPASITELIDSFINVEDQNNEVKERVAFALFVFFLDETLCLDNGGKPSQTIRYVTSSVLVDVKGIVIPNTRKQLNVNHEYKWHFTTSSPKAESFYQEVLPNSRKQVESWLQDITNLRKVYSEALSPSSTLQELDLNSSLPTQDPIISGQKRRRYDLDEYLEEDKSSVVNDTIKAKDFDESVPAKIRKISVSKKTLKSNW red1-smt3-1 895718 red1_yeast Red1C 895722 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P14291:p.Ser715Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P14291:p.Thr717Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false smt3_yeast SMT3 895723 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f1a mint red1-smt3-2 895718 red1_yeast Red1C 895722 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P14291:p.Ile758Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false smt3_yeast SMT3 895723 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f1a mint red1-smt3-3 895718 smt3_yeast SMT3 895723 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false red1_yeast Red1C 895722 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P14291:p.Ser715Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P14291:p.Ile758Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P14291:p.Thr717Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f1a mint red1-red1 895718 red1_yeast RED1 C 895722 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P14291:p.Ile758Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false red1_yeast RED1 C 895722 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell P14291:p.Ile758Arg mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mint ts1 red1-red1-1 895718 red1_yeast RED1 C 895722 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P14291:p.Ser715Arg mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P14291:p.Thr717Arg mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P14291:p.Ile758Ser mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false red1_yeast RED1 C 895722 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P14291:p.Thr717Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P14291:p.Ser715Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P14291:p.Ile758Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false mint ts1 zip1-red1 895718 red1_yeast RED1C 895722 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false zip1_yeast ZIP1 895724 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P31111:p.Asp863Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P31111:p.Glu862Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P31111:p.Gln864Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f6a mint hop1-red1 895718 hop1_yeast HOP1 895725 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false red1_yeast RED1 895722 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false mint ts2 smt3-zip1 895719 smt3_yeast SMT3 895723 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tandem tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false zip1_yeast ZIP1 895724 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f6d mint red1-smt3-5 895719 red1_yeast red1 895722 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false smt3_yeast SMT3 895723 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tandem tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f6c mint hop1-red1-1 895719 red1_yeast RED1 895722 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false hop1_yeast HOP1 895725 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false mint fs2a red1-zip1 895719 zip1_yeast ZIP1 895724 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell red1_yeast RED1 895722 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false mint fs1 red1-smt3-4 895720 smt3_yeast SMT3 895723 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified undefined mutation mutation disrupting mutation disrupting interaction mutation disrupting undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tandem tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false red1_yeast RED1 895722 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tandem tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f1c mint smt3-smt3-2 895720 smt3_yeast SMT3 895723 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified tandem tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false smt3_yeast SMT3 895723 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f5 homomint mint red1-hop1 895721 hop1_yeast HOP1 895725 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level red1_yeast RED1 895722 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mint fs3