MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint ji-2010-1 How baculovirus polyhedra fit square pegs into round holes to robustly package viruses. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ji X., Sutton G., Evans G., Axford D., Owen R., Stuart DI. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation pyhd_npvac Polyhedrin PH P29 POLH Major occlusion protein protein protein npvac Autographa californica nuclear polyhedrosis virus (AcMNPV) AcMNPV MPDYSYRPTIGRTYVYDNKYYKNLGAVIKNAKRKKHFAEHEIEEATLDPLDNYLVAEDPFLGPGKNQKLTLFKEIRNVKPDTMKLVVGWKGKEFYRETWTRFMEDSFPIVNDQEVMDVFLVVNMRPTRPNRCYKFLAQHALRCDPDYVPHDVIRIVEPSWVGSNNEYRISLAKKGGGCPIMNLHSEYTNSFEQFIDRVIWENFYKPIVYIGTDSAEEEEILLEVSLVFKVKEFAPDAPLFTGPAY mint ph-2 896043 pyhd_npvac Polyhedrin 896044 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 3.0 direct interaction direct interaction false false false mint f1c f1d f1e t1 sf3 sf7 ph-2 896043 pyhd_npvac Polyhedrin 896044 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 12.0 covalent binding covalent binding false false false mint f1e f4a sf4 ph-2 896043 pyhd_npvac Polyhedrin 896044 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 covalent binding covalent binding false false false f5a mint