MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint siergiejuk-2009-1 Cullin neddylation and substrate-adaptors counteract SCF inhibition by the CAND1-like protein Lag2 in Saccharomyces cerevisiae. yeast Saccharomyces cerevisiae Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Siergiejuk E., Scott DC., Schulman BA., Hofmann K., Kurz T., Peter M. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation siergiej-2009-1 Cullin neddylation and substrate-adaptors counteract SCF inhibition by the CAND1-like protein Lag2 in Saccharomyces cerevisiae. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Siergiejuk E., Scott DC., Schulman BA., Hofmann K., Kurz T., Peter M. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation siergiej-2009-2 Cullin neddylation and substrate-adaptors counteract SCF inhibition by the CAND1-like protein Lag2 in Saccharomyces cerevisiae. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Siergiejuk E., Scott DC., Schulman BA., Hofmann K., Kurz T., Peter M. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation siergiej-2009-3 Cullin neddylation and substrate-adaptors counteract SCF inhibition by the CAND1-like protein Lag2 in Saccharomyces cerevisiae. in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Siergiejuk E., Scott DC., Schulman BA., Hofmann K., Kurz T., Peter M. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation siergiej-2009-4 Cullin neddylation and substrate-adaptors counteract SCF inhibition by the CAND1-like protein Lag2 in Saccharomyces cerevisiae. yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Siergiejuk E., Scott DC., Schulman BA., Hofmann K., Kurz T., Peter M. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation skp1_yeast Suppressor of kinetochore protein 1 SKP1 CBF3D YDR328C D9798.14 Centromere DNA-binding protein complex CBF3 subunit D E3 ubiquitin ligase complex SCF subunit SKP1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVTSNVVLVSGEGERFTVDKKIAERSLLLKNYLNDMHDSNLQNNSDSESDSDSETNHKSKDNNNGDDDDEDDDEIVMPVPNVRSSVLQKVIEWAEHHRDSNFPDEDDDDSRKSAPVDSWDREFLKVDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTPEEEAAIRRENEWAEDR 746DDE6470A69432 cdc53_yeast Cell division control protein 53 CDC53 YDL132W D2190 Cullin-A E3 ubiquitin ligase complex SCF subunit CDC53 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSETLPRSDDLEATWNFIEPGINQILGNEKNQASTSKRVYKILSPTMYMEVYTAIYNYCVNKSRSSGHFSTDSRTGQSTILVGSEIYEKLKNYLKNYILNFKQSNSETFLQFYVKRWKRFTIGAIFLNHAFDYMNRYWVQKERSDGKRHIFDVNTLCLMTWKEVMFDPSKDVLINELLDQVTLGREGQIIQRSNISTAIKSLVALGIDPQDLKKLNLNVYIQVFEKPFLKKTQEYYTQYTNDYLEKHSVTEYIFEAHEIIKREEKAMTIYWDDHTKKPLSMALNKVLITDHIEKLENEFVVLLDARDIEKITSLYALIRRDFTLIPRMASVFENYVKKTGENEISSLLAMHKHNIMKNENANPKKLALMTAHSLSPKDYIKKLLEVHDIFSKIFNESFPDDIPLAKALDNACGAFININEFALPAGSPKSATSKTSEMLAKYSDILLKKATKPEVASDMSDEDIITIFKYLTDKDAFETHYRRLFAKRLIHGTSTSAEDEENIIQRLQAANSMEYTGKITKMFQDIRLSKILEDDFAVALKNEPDYSKAKYPDLQPFVLAENMWPFSYQEVEFKLPKELVPSHEKLKESYSQKHNGRILKWLWPLCRGELKADIGKPGRMPFNFTVTLFQMAILLLYNDADVLTLENIQEGTSLTIQHIAAAMVPFIKFKLIQQVPPGLDALVKPETQFKLSRPYKALKTNINFASGVKNDILQSLSGGGHDNHGNKLGNKRLTEDERIEKELNTERQIFLEACIVRIMKAKRNLPHTTLVNECIAQSHQRFNAKVSMVKRAIDSLIQKGYLQRGDDGESYAYLA 22BC8B35034EDDEF lag2_yeast Cullin-associated NEDD8-dissociated protein 1 homolog LAG2 CAND1 homolog Longevity-assurance protein 2 YOL025W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLHISKLIEQYRSTKDNDLKYMLLRQNFKINDIEDELAPLVNELLLPVLVEEQDMEILNLVSFQVLPDLVLSMISDPAAAQLGWVISLICDPLLNQSMIHANRSFVLIETLRNVLQKIENSPHLDYHQPVNSSLEFISKFIVEMKRHMCDVDAAQLSHSLSESNMLIYIESLNLLLKFSFFSDAASPSVMVTLPFDILNDVFTIAQDYSATNTNESIDRITEKLLLTSTQLTHPVDLENLCPKMKYNTLAAVSRIWYKFGPIVDKLFTNRLLPVLFPPQMGEECNVEDVLEIVHNFHPYFSIRRLKDNRPLLSDSTISQLREGLFGMLSILNDSLTRTQNENDHGSDNLIDSDDGFGSDNDPEQQAYLDELVSEGYDENMYDGDTDDEDADDINVEKNDEATKDITETNKILLIFSELHYPQEERFSELLVELQTKIAINTSLIDKILSKETTELPTHNGEIADLNEILNEVKGNKPIRKNVIFCTLAHTLSLQSGSELSVLQLSIEVIDHLLVKNHSNNITRGEQFQLIKLILPHLKTNKSFIDTLKAGNFTQKIDEGVTLRTMILSLLLQLFPLDYSMLGEILPTIARYSVRDKDLGVRDLSFQLLDQILRTYYNYLIGIDWEWYKDDFYQVLQETCIKKDINTNLLLQFPPYLPHD rbx1_yeast RING-box protein HRT1 E3 ubiquitin-protein ligase complex SCF subunit HRT1 High level expression reduces Ty3 transposition protein 1 HRT1 RBX1 ROC1 Regulator of cullins protein 1 YOL133W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNEVDRMDVDEDESQNIAQSSNQSAPVETKKKRFEIKKWTAVAFWSWDIAVDNCAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKTRDACPLDNQPWQLARCGR A9C3193E48CAF881 dcn1_yeast Defective in cullin neddylation protein 1 L3111 YLR128W DCN1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNNKIKRKDASPEQEAIESFTSLTKCDPKVSRKYLQRNHWNINYALNDYYDKEIGTFTDEVSTVAHPPVYPKELTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQDQQ rub1_yeast NEDD8-like protein RUB1 RUB1 YDR139C Ubiquitin-like protein RUB1 YD9302.15C Related to ubiquitin protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIVKVKTLTGKEISVELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIDDKLTVTDAHLVEGMQLHLVLTLRGGN F05DBF3C8E464FD1 skp1-cdc53 874782 skp1_yeast SKP1 874787 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level cdc53_yeast CDC53 874788 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false homomint mint fs2b lag2-cdc53-1 874782 lag2_yeast LAG2 874789 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level cdc53_yeast CDC53 874788 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false mint f1c f1b lag2-cdc53-2 874782 cdc53_yeast CDC53 874788 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level lag2_yeast LAG2 874789 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q92325:p.Gly551Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q92325:p.Asn552Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f1d mint lag2-cdc53-3 874782 cdc53_yeast CDC53 874788 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level lag2_yeast LAG2 874789 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q92325:p.Met23Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q92325:p.Asp19Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q92325:p.Asp17Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q92325:p.Tyr22Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f1d mint lag2-cdc53-4 874782 lag2_yeast LAG2 874789 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell cdc53_yeast CDC53 874788 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f5c mint cdc53-lag2-1 874783 lag2_yeast LAG2 874789 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell cdc53_yeast CDC53 874788 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false mint fs2a cdc53-hrt1-2 874784 rbx1_yeast HRT1 874790 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified cdc53_yeast CDC53 874788 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false lag2_yeast LAG2 874789 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified association association false false false f3a homomint mint cdc53-dcn1 874785 lag2_yeast LAG2 874789 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified cdc53_yeast CDC53 874788 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified dcn1_yeast DCN1 874791 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false association association false false false homomint mint fs5a rub1-cdc53 874786 rub1_yeast RUB1 874792 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false lag2_yeast LAG2 874789 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level neddylated lysine neddylated lysine neddylated lysine neddylated lysine western blot western blot Immuno blot Immuno blot undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false resulting-ptm cdc53_yeast CDC53 874788 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false f4b homomint mint