MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint bonsor-2009-3 Allosteric beta-propeller signalling in TolB and its manipulation by translocating colicins. in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Bonsor DA., Hecht O., Vankemmelbeke M., Sharma A., Krachler AM., Housden NG., Lilly KJ., James R., Moore GR., Kleanthous C. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation bonsor-2009-2 Allosteric beta-propeller signalling in TolB and its manipulation by translocating colicins. in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Bonsor DA., Hecht O., Vankemmelbeke M., Sharma A., Krachler AM., Housden NG., Lilly KJ., James R., Moore GR., Kleanthous C. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation bonsor-2009-4 Allosteric beta-propeller signalling in TolB and its manipulation by translocating colicins. in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Bonsor DA., Hecht O., Vankemmelbeke M., Sharma A., Krachler AM., Housden NG., Lilly KJ., James R., Moore GR., Kleanthous C. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation bonsor-2009-1 Allosteric beta-propeller signalling in TolB and its manipulation by translocating colicins. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bonsor DA., Hecht O., Vankemmelbeke M., Sharma A., Krachler AM., Housden NG., Lilly KJ., James R., Moore GR., Kleanthous C. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation tolb_ecoli Tol-Pal system protein TolB tolB b0740 JW5100 protein protein ecoli Escherichia coli (strain K12) MKQALRVAFGFLILWASVLHAEVRIVIDSGVDSGRPIGVVPFQWAGPGAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYL mint pal_ecoli Peptidoglycan-associated lipoprotein pal excC b0741 JW0731 Tol-Pal system lipoprotein Pal protein protein ecoli Escherichia coli (strain K12) MQLNKVLKGLMIALPVMAIAACSSNKNASNDGSEGMLGAGTGMDANGGNGNMSSEEQARLQMQQLQQNNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVY tola_ecoli Tol-Pal system protein TolA tolA cim excC lky b0739 JW0729 protein protein ecoli Escherichia coli (strain K12) MSKATEQNDKLKRAIIISAVLHVILFAALIWSSFDENIEASAGGGGGSSIDAVMVDSGAVVEQYKRMQSQESSAKRSDEQRKMKEQQAAEELREKQAAEQERLKQLEKERLAAQEQKKQAEEAAKQAELKQKQAEEAAAKAAADAKAKAEADAKAAEEAAKKAAADAKKKAEAEAAKAAAEAQKKAEAAAAALKKKAEAAEAAAAEARKKAATEAAEKAKAEAEKKAAAEKAAADKKAAAEKAAADKKAAEKAAAEKAAADKKAAAEKAAADKKAAAAKAAAEKAAAAKAAAEADDIFGELSSGKNAPKTGGGAKGNNASPAGSGNTKNNGASGADINNYAGQIKSAIESKFYDASSYAGKTCTLRIKLAPDGMLLDIKPEGGDPALCQAALAAAKLAKIPKPPSQAVYEVFKNAPLDFKP cea9_ecolx Colicin-E9 col cei protein protein ecolx Escherichia coli MSGGDGRGHNTGAHSTSGNINGGPTGIGVSGGASDGSGWSSENNPWGGGSGSGIHWGGGSGRGNGGGNGNSGGGSGTGGNLSAVAAPVAFGFPALSTPGAGGLAVSISASELSAAIAGIIAKLKKVNLKFTPFGVVLSSLIPSEIAKDDPNMMSKIVTSLPADDITESPVSSLPLDKATVNVNVRVVDDVKDERQNISVVSGVPMSVPVVDAKPTERPGVFTASIPGAPVLNISVNDSTPAVQTLSPGVTNNTDKDVRPAGFTQGGNTRDAVIRFPKDSGHNAVYVSVSDVLSPDQVKQRQDEENRRQQEWDATHPVEAAERNYERARAELNQANEDVARNQERQAKAVQVYNSRKSELDAANKTLADAIAEIKQFNRFAHDPMAGGHRMWQMAGLKAQRAQTDVNNKQAAFDAAAKEKSDADAALSAAQERRKQKENKEKDAKDKLDKESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKSFDDFRKAVWEEVSKDPELSKNLNPSNKSSVSKGYSPFTPKNQQVGGRKVYELHHDKPISQGGEVYDMDNIRVTTPKRHIDIHRGK pal-tolb-1 959158 tolb_ecoli tolB 959162 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified pal_ecoli Pal 959163 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false 959158 t2 mint pal-tolb-2 959158 tolb_ecoli tolB 959162 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified region mutation decreasing interaction required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false pal_ecoli Pal 959163 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false 959158 t2 mint pal-tolb-3 959158 tolb_ecoli tolB 959162 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified region mutation decreasing interaction required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false pal_ecoli Pal 959163 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false 959158 t2 mint tola-tolb-2 959158 tolb_ecoli tolB 959162 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified region mutation decreasing interaction required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false tola_ecoli TolA-III 959164 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 959158 mint f3b t2 tola-tolb-3 959158 tolb_ecoli tolB 959162 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified region mutation decreasing interaction required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false tola_ecoli TolA-III 959164 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 959158 mint f3b t2 col-tola 959158 tolb_ecoli tolB 959162 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified tola_ecoli TolA-III 959164 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cea9_ecolx ColE9 959165 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false T domain physical association physical association false false false 959158 mint f6b t2 col-tolb 959158 tolb_ecoli tolB 959162 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified cea9_ecolx ColE9 959165 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false T domain direct interaction direct interaction false false false t2 mint col-tolb-1 959158 tolb_ecoli tolB 959162 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified region mutation increasing interaction binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false cea9_ecolx ColE9 959165 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false T domain direct interaction direct interaction false false false 959158 t2 mint col-tolb-2 959158 tolb_ecoli tolB 959162 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified regioj mutation increasing interaction binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false cea9_ecolx ColE9 959165 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false T domain direct interaction direct interaction false false false 959158 t2 mint tola-tolb 959159 tolb_ecoli tolB 959162 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified undefined mutation mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false tola_ecoli TolA-III 959164 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f3a mint tola-tolb-1 959159 tolb_ecoli tolB 959162 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified undefined mutation mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false tola_ecoli TolA-III 959164 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f3a mint col-tolb-3 959160 tolb_ecoli tolB 959162 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified cea9_ecolx ColE9 959165 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false T domain direct interaction direct interaction false false false mint f8 tola-tolb-4 959160 tolb_ecoli tolB 959162 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified tola_ecoli TolA-III 959164 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f7b mint pal-tolb-4 959161 tolb_ecoli tolB 959162 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified pal_ecoli Pal 959163 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f1b mint