IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ santama-2005-1 Characterization of hCINAP, a novel coilin-interacting protein encoded by a transcript from the transcription factor TAFIID32 locus. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Santama N., Ogg SC., Malekkou A., Zographos SE., Weis K., Lamond AI. a.i.lamond@lifesci.dundee.ac.uk, santama@ucy.ac.cy J. Biol. Chem. (0021-9258) 2005 Only protein-protein interactions imex curation santama-2005-2 Characterization of hCINAP, a novel coilin-interacting protein encoded by a transcript from the transcription factor TAFIID32 locus. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Santama N., Ogg SC., Malekkou A., Zographos SE., Weis K., Lamond AI. Coilin was detected by immunostaining. a.i.lamond@lifesci.dundee.ac.uk, santama@ucy.ac.cy J. Biol. Chem. (0021-9258) 2005 Only protein-protein interactions imex curation santama-2005-3 Characterization of hCINAP, a novel coilin-interacting protein encoded by a transcript from the transcription factor TAFIID32 locus. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Santama N., Ogg SC., Malekkou A., Zographos SE., Weis K., Lamond AI. a.i.lamond@lifesci.dundee.ac.uk, santama@ucy.ac.cy J. Biol. Chem. (0021-9258) 2005 Only protein-protein interactions imex curation santama-2005-4 Characterization of hCINAP, a novel coilin-interacting protein encoded by a transcript from the transcription factor TAFIID32 locus. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Santama N., Ogg SC., Malekkou A., Zographos SE., Weis K., Lamond AI. a.i.lamond@lifesci.dundee.ac.uk, santama@ucy.ac.cy J. Biol. Chem. (0021-9258) 2005 Only protein-protein interactions imex curation santama-2005-5 Characterization of hCINAP, a novel coilin-interacting protein encoded by a transcript from the transcription factor TAFIID32 locus. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Santama N., Ogg SC., Malekkou A., Zographos SE., Weis K., Lamond AI. a.i.lamond@lifesci.dundee.ac.uk, santama@ucy.ac.cy J. Biol. Chem. (0021-9258) 2005 Only protein-protein interactions imex curation kad6_human Adenylate kinase isoenzyme 6 AK6 Adrenal gland protein AD-004 CINAP Coilin-interacting nuclear ATPase protein Dual activity adenylate kinase/ATPase AD-004 CGI-137 protein protein human Homo sapiens Human MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS coil_human Coilin COIL CLN80 p80-coilin protein protein human Homo sapiens Human MAASETVRLRLQFDYPPPATPHCTAFWLLVDLNRCRVVTDLISLIRQRFGFSSGAFLGLYLEGGLLPPAESARLVRDNDCLRVKLEERGVAENSVVISNGDINLSLRKAKKRAFQLEEGEETEPDCKYSKKHWKSRENNNNNEKVLDLEPKAVTDQTVSKKNKRKNKATCGTVGDDNEEAKRKSPKKKEKCEYKKKAKNPKSPKVQAVKDWANQRCSSPKGSARNSLVKAKRKGSVSVCSKESPSSSSESESCDESISDGPSKVTLEARNSSEKLPTELSKEEPSTKNTTADKLAIKLGFSLTPSKGKTSGTTSSSSDSSAESDDQCLMSSSTPECAAGFLKTVGLFAGRGRPGPGLSSQTAGAAGWRRSGSNGGGQAPGASPSVSLPASLGRGWGREENLFSWKGAKGRGMRGRGRGRGHPVSCVVNRSTDNQRQQQLNDVVKNSSTIIQNPVETPKKDYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQVDIEILSSLPALREPGKFDLVYHNENGAEVVEYAVTQESKITVFWKELIDPRLIIESPSNTSSTEPA coilin-cinap 971769 n/a 971774 unspecified role unspecified role prey prey n/a 971775 unspecified role unspecified role bait bait c terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig 1A, Fig 7A. coilin-cinap-1 971770 n/a 971775 unspecified role unspecified role neutral component neutral component n/a 971774 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false The nuclear bodies containing hCINAP co-localized with anti-coilin antibodies, indicating that the structures are Cajal bodies. Nuclei transfected with YFP-hCINAP have a reduced number of Cajal bodies per nucleus. Fig 5, Fig 8. coilin-cinap-2 971771 n/a 971774 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 971775 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region thioredoxin tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig 6B. Coilin is detectable on the glutathione beads only in the presence of hCINAP and the hCINAP-coilin interaction appears to be ATP-independent. coilin-cinap-3 971772 n/a 971774 unspecified role unspecified role bait bait region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 971775 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association false false false Fig 6C. Binding of endogenous coilin to YFP-tagged hCINAP in transiently transfected HeLa cells. coilin-cinap-5 971773 n/a 971775 unspecified role unspecified role prey prey c terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 35S- Methionine 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 971774 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false An essential CINAP interaction domain lies within the carboxyl-terminal 214 amino acid residues of coilin. Fig 7B. The C1 fragment is recovered in the pellet of the glutathione agarose pull-down only in the presence of GST-CINAP and is absent from the pellet when GST-CINAP is not expressed.