IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kamura_t-2004-1 VHL-box and SOCS-box domains determine binding specificity for Cul2-Rbx1 and Cul5-Rbx2 modules of ubiquitin ligases human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Takumi Kamura, Katsumi Maenaka, Shuhei Kotoshiba, Masaki Matsumoto, Daisuke Kohda, Ronald C. Conaway, Joan Weliky Conaway, Keiichi I. Nakayama Apoptosis - Interactions involving proteins with a function related to apoptosis nakayak1@bioreg.kyushu-u.ac.jp Genes Dev 2004 Only protein-protein interactions imex curation Curation by: Molecular Connections Pvt. Ltd kamura_t-2004-2 VHL-box and SOCS-box domains determine binding specificity for Cul2-Rbx1 and Cul5-Rbx2 modules of ubiquitin ligases human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Takumi Kamura, Katsumi Maenaka, Shuhei Kotoshiba, Masaki Matsumoto, Daisuke Kohda, Ronald C. Conaway, Joan Weliky Conaway, Keiichi I. Nakayama Apoptosis - Interactions involving proteins with a function related to apoptosis nakayak1@bioreg.kyushu-u.ac.jp Genes Dev 2004 Only protein-protein interactions imex curation Curation by: Molecular Connections Pvt. Ltd kamura_t-2004-4 VHL-box and SOCS-box domains determine binding specificity for Cul2-Rbx1 and Cul5-Rbx2 modules of ubiquitin ligases human-786_o Homo sapiens renal cell adenocarcinoma 786_o Human renal cell adenocarcinoma cell line CRL-1932 is the ATCC identifier. ATCC identifier is CRL-1932. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Takumi Kamura, Katsumi Maenaka, Shuhei Kotoshiba, Masaki Matsumoto, Daisuke Kohda, Ronald C. Conaway, Joan Weliky Conaway, Keiichi I. Nakayama Apoptosis - Interactions involving proteins with a function related to apoptosis nakayak1@bioreg.kyushu-u.ac.jp Genes Dev 2004 Only protein-protein interactions imex curation Curation by: Molecular Connections Pvt. Ltd kamura_t-2004-3 VHL-box and SOCS-box domains determine binding specificity for Cul2-Rbx1 and Cul5-Rbx2 modules of ubiquitin ligases mouse-raw264_7 Mus musculus monocyte macrophage cell line RAW264 raw264_7 Mouse monocyte macrophage cellline RAW264.7 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Takumi Kamura, Katsumi Maenaka, Shuhei Kotoshiba, Masaki Matsumoto, Daisuke Kohda, Ronald C. Conaway, Joan Weliky Conaway, Keiichi I. Nakayama Apoptosis - Interactions involving proteins with a function related to apoptosis nakayak1@bioreg.kyushu-u.ac.jp Genes Dev 2004 Only protein-protein interactions imex curation Curation by: Molecular Connections Pvt. Ltd rbx1_human E3 ubiquitin-protein ligase RBX1 RBX1 RNF75 ROC1 Regulator of cullins 1 RING finger protein 75 Protein ZYP RING-box protein 1 E3 ubiquitin-protein transferase RBX1 protein protein human Homo sapiens Human MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH cul2_human Cullin-2 CUL2 protein protein human Homo sapiens Human MSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYTETKIFLENHVRHLHKRVLESEEQVLVMYHRYWEEYSKGADYMDCLYRYLNTQFIKKNKLTEADLQYGYGGVDMNEPLMEIGELALDMWRKLMVEPLQAILIRMLLREIKNDRGGEDPNQKVIHGVINSFVHVEQYKKKFPLKFYQEIFESPFLTETGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEIRCRKYLHPSSYTKVIHECQQRMVADHLQFLHAECHNIIRQEKKNDMANMYVLLRAVSTGLPHMIQELQNHIHDEGLRATSNLTQENMPTLFVESVLEVHGKFVQLINTVLNGDQHFMSALDKALTSVVNYREPKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDRLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIKNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAESSFSLNMNFSSKRTKFKITTSMQKDTPQEMEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA vhl_human von Hippel-Lindau disease tumor suppressor VHL pVHL Protein G7 protein protein human Homo sapiens Human MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD elob_human Elongin-B ELOB Elongin 18 kDa subunit RNA polymerase II transcription factor SIII subunit B SIII p18 TCEB2 Transcription elongation factor B polypeptide 2 protein protein human Homo sapiens Human MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ eloc_human Elongin-C ELOC Elongin 15 kDa subunit RNA polymerase II transcription factor SIII subunit C SIII p15 TCEB1 Transcription elongation factor B polypeptide 1 protein protein human Homo sapiens Human MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC rbx2_human RING-box protein 2 RNF7 RBX2 ROC2 SAG RING finger protein 7 Regulator of cullins 2 CKII beta-binding protein 1 Sensitive to apoptosis gene protein protein protein human Homo sapiens Human MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK cul5_human Cullin-5 CUL5 VACM1 Vasopressin-activated calcium-mobilizing receptor 1 protein protein human Homo sapiens Human MATSNLLKNKGSLQFEDKWDFMRPIVLKLLRQESVTKQQWFDLFSDVHAVCLWDDKGPAKIHQALKEDILEFIKQAQARVLSHQDDTALLKAYIVEWRKFFTQCDILPKPFCQLEITLMGKQGSNKKSNVEDSIVRKLMLDTWNESIFSNIKNRLQDSAMKLVHAERLGEAFDSQLVIGVRESYVNLCSNPEDKLQIYRDNFEKAYLDSTERFYRTQAPSYLQQNGVQNYMKYADAKLKEEEKRALRYLETRRECNSVEALMECCVNALVTSFKETILAECQGMIKRNETEKLHLMFSLMDKVPNGIEPMLKDLEEHIISAGLADMVAAAETITTDSEKYVEQLLTLFNRFSKLVKEAFQDDPRFLTARDKAYKAVVNDATIFKLELPLKQKGVGLKTQPESKCPELLANYCDMLLRKTPLSKKLTSEEIEAKLKEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISADSEIEENMVEWLREVGMPADYVNKLARMFQDIKVSEDLNQAFKEMHKNNKLALPADSVNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATELPDAELRRTLWSLVAFPKLKRQVLLYEPQVNSPKDFTEGTLFSVNQEFSLIKNAKVQKRGKINLIGRLQLTTERMREEENEGIVQLRILRTQEAIIQIMKMRKKISNAQLQTELVEILKNMFLPQKKMIKEQIEWLIEHKYIRRDESDINTFIYMA socs3_human Suppressor of cytokine signaling 3 Cytokine-inducible SH2 protein 3 STAT-induced STAT inhibitor 3 SOCS3 CIS3 SSI3 protein protein human Homo sapiens Human MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL spsb1_human SPRY domain-containing SOCS box protein 1 SSB1 SPSB1 protein protein human Homo sapiens Human MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNNDRSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDLCRRSVRLALGRERLGEIHTLPLPASLKAYLLYQ spsb2_human SPRY domain-containing SOCS box protein 2 SPSB2 GRCC9 SSB2 Gene-rich cluster protein C9 protein protein human Homo sapiens Human MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERRPVAQSTDGARGKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQTDHYAALLGSNSESWGWDIGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGGTYLGPAFRGLKGRTLYPAVSAVWGQCQVRIRYLGERRAEPHSLLHLSRLCVRHNLGDTRLGQVSALPLPPAMKRYLLYQ rb40c_human Ras-related protein Rab-40C SOCS box-containing protein RAR3 Rar-like protein Ras-like protein family member 8C RAB40C RARL RASL8C protein protein human Homo sapiens Human MGSQGSPVKSYDYLLKFLLVGDSDVGKGEILESLQDGAAESPYAYSNGIDYKTTTILLDGRRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNRWSFDGIDRWIKEIDEHAPGVPRILVGNRLHLAFKRQVPTEQARAYAEKNCMTFFEVSPLCNFNVIESFTELSRIVLMRHGMEKIWRPNRVFSLQDLCCRAIVSCTPVHLIDKLPLPVTIKSHLKSFSMANGMNAVMMHGRSYSLASGAGGGGSKGNSLKRSKSIRPPQSPPQNCSRSNCKIS wsb1_mouse WD repeat and SOCS box-containing protein 1 Wsb1 protein protein mouse Mus musculus Mouse MASFPPRVNEKEIVRSRTIGELLAPAAPFDKKCGGENWTVAFAPDGSYFAWSQGYRIVKLVPWSQCRKNFLLHGSKNVTNSSCLKLARQNSNGGQKNKPPEHVIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQLLLATGLNNGRIKIWDVYTGKLLLNLVDHIEMVRDLTFAPDGSLLLVSASRDKTLRVWDLKDDGNMVKVLRAHQNWVYSCAFSPDCSMLCSVGASKAVFLWNMDKYTMIRKLEGHHHDVVACDFSPDGALLATASYDTRVYVWDPHNGDLLMEFGHLFPSPTPIFAGGANDRWVRAVSFSHDGLHVASLADDKMVRFWRIDEDCPVQVAPLSNGLCCAFSTDGSVLAAGTHDGSVYFWATPRQVPSLQHICRMSIRRVMSTQEVQKLPVPSKILAFLSYRG lrc41_mouse Leucine-rich repeat-containing protein 41 Protein Muf1 Muf1 Lrrc41 protein protein mouse Mus musculus Mouse MAAPEAWRARSCWFCEVAAATTMEATSREAAPAKSSASGPSAPPALFELCGRAVSAHMGVLESGVWALPGPILQSILPLLNIYYLERIEETALKKGLSTQAIWRRLWDELMKTRPSSLESVTCWRAKFMEAFFSHVLRGTIDVSSDKRLCDQRFSPLLHSSRHVRQLTICNMLQGATELVAEPNRRVLETLASSLHTLKFRHLLFSDVAAQQSLRQLLHQLIHHGAVSQVSLYSWPVPESALFILILTMSAGFWQPGPGSLPCRLCGEASRGRAPSRDEGSLLLGSRRPRRDAAERCAAALMATRRKSEVKQMPRAVPPTRVTRRSTQESLAIGGTDSKLYLPATSYEASGTKQPSAPAAASASSSTSSKRAPASSASQPKPLKRFKRAAGKKGPRTRQGSGAESEDLYDFVFIVAGEKEDGEEMEIGEVACGALDGSDPSCLGLPALEASQRFRSISTLELFTVPLSTEAALTLCHLLSSWVSLESLTLSYNGLGSNIFRLLDSLRALSGQAGCRLRALHLSDLFSPLPILELTRAIVRALPLLRVLSIRVDHPSQRDNPAVPENAGPPGHIVGDEEIPENCLEQLEMGFPRGAQPAPLLCSVLKASGSLQQLSLDSATFASPQDFGLVLQTLKEHNLSLKRLSFHDMNLADCQSEVLFLLKNLTLQEITFSFCRLFEKRPVQFLPEMVAAMKGNSTLKGLRLPGNRLGNAGLLALADVFSEDSSSSLCQLDISSNCIKPDGLLEFAKRLERWGRGAFGHLRLFQNWLDQDAVTAREAIRRLRATCHVVSDSWDSTQAFADYVSTM socs1_mouse Suppressor of cytokine signaling 1 JAK-binding protein STAT-induced STAT inhibitor 1 Cish1 Ssi1 Socs1 protein protein mouse Mus musculus Mouse MVARNQVAADNAISPAAEPRRRSEPSSSSSSSSPAAPVRPRPCPAVPAPAPGDTHFRTFRSHSDYRRITRTSALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRETFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQRIVAAVGRENLARIPLNPVLRDYLSSFPFQI llr1_human Leucine-rich repeat protein 1 LRR1 PPIL5 LRR-repeat protein 1 4-1BB-mediated-signaling molecule 4-1BBlrr Peptidylprolyl isomerase-like 5 protein protein human Homo sapiens Human MKLHCEVEVISRHLPALGLRNRGKGVRAVLSLCQQTSRSQPPVRAFLLISTLKDKRGTRYELRENIEQFFTKFVDEGKATVRLKEPPVDICLSKAISSSLKGFLSAMRLAHRGCNVDTPVSTLTPVKTSEFENFKTKMVITSKKDYPLSKNFPYSLEHLQTSYCGLVRVDMRMLCLKSLRKLDLSHNHIKKLPATIGDLIHLQELNLNDNHLESFSVALCHSTLQKSLRSLDLSKNKIKALPVQFCQLQELKNLKLDDNELIQFPCKIGQLINLRFLSAARNKLPFLPSEFRNLSLEYLDLFGNTFEQPKVLPVIKLQAPLTLLESSARTILHNRIPYGSHIIPFHLCQDLDTAKICVCGRFCLNSFIQGTTTMNLHSVAHTVVLVDNLGGTEAPIISYFCSLGCYVNSSDMLK fem1b_human Protein fem-1 homolog B FEM1B KIAA0396 F1AA FEM1-beta Fem-1-like death receptor-binding protein alpha Fem-1-like in apoptotic pathway protein alpha protein protein human Homo sapiens Human MEGLAGYVYKAASEGKVLTLAALLLNRSESDIRYLLGYVSQQGGQRSTPLIIAARNGHAKVVRLLLEHYRVQTQQTGTVRFDGYVIDGATALWCAAGAGHFEVVKLLVSHGANVNHTTVTNSTPLRAACFDGRLDIVKYLVENNANISIANKYDNTCLMIAAYKGHTDVVRYLLEQRADPNAKAHCGATALHFAAEAGHIDIVKELIKWRAAIVVNGHGMTPLKVAAESCKADVVELLLSHADCDRRSRIEALELLGASFANDRENYDIIKTYHYLYLAMLERFQDGDNILEKEVLPPIHAYGNRTECRNPQELESIRQDRDALHMEGLIVRERILGADNIDVSHPIIYRGAVYADNMEFEQCIKLWLHALHLRQKGNRNTHKDLLRFAQVFSQMIHLNETVKAPDIECVLRCSVLEIEQSMNRVKNISDADVHNAMDNYECNLYTFLYLVCISTKTQCSEEDQCKINKQIYNLIHLDPRTREGFTLLHLAVNSNTPVDDFHTNDVCSFPNALVTKLLLDCGAEVNAVDNEGNSALHIIVQYNRPISDFLTLHSIIISLVEAGAHTDMTNKQNKTPLDKSTTGVSEILLKTQMKMSLKCLAARAVRANDINYQDQIPRTLEEFVGFH spsb4_human SPRY domain-containing SOCS box protein 4 SPSB4 SSB4 protein protein human Homo sapiens Human MGQKLSGSLKSVEVREPALRPAKRELRGAEPGRPARLDQLLDMPAAGLAVQLRHAWNPEDRSLNVFVKDDDRLTFHRHPVAQSTDGIRGKVGHARGLHAWQINWPARQRGTHAVVGVATARAPLHSVGYTALVGSDAESWGWDLGRSRLYHDGKNQPGVAYPAFLGPDEAFALPDSLLVVLDMDEGTLSFIVDGQYLGVAFRGLKGKKLYPVVSAVWGHCEVTMRYINGLDPEPLPLMDLCRRSIRSALGRQRLQDISSLPLPQSLKNYLQYQ vhl-m1_human_protein VHL-SPSB1 chimeric protein protein protein human Homo sapiens Human MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENHTLPLPASLKAYLLYQ An amino acid sequence which is not represented in UniProt Chimeric protein created from VHL (P40337) and SPSB1 (Q96BD6) vhl-m2_human_protein VHL-RAR3 chimeric protein protein protein human Homo sapiens Human MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENIDKLPLPVTIKSHLKSFSMAN An amino acid sequence which is not represented in UniProt Chimeric protein created from VHL (P40337) and RAR3 (Q96S21) rbx1_mouse E3 ubiquitin-protein ligase RBX1 RING finger protein 75 RING-box protein 1 Rbx1 E3 ubiquitin-protein transferase RBX1 protein protein mouse Mus musculus Mouse MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH cul2_mouse Cullin-2 Cul2 protein protein mouse Mus musculus Mouse MSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYAETKIFLESHVRHLYKRVLESEEQVLVMYHRYWEEYSKGADYMDCLYRYLNTQYIKKNKLTEADIQYGYGGVDMNEPLMEIGELALDMWRKLMVEPLQNILIRMLLREIKNDRGGEDPNQKVIHGVINSFVHVEQYKKKFPLKFYQGIFVSPFLTETGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEIRCRKYLHPSSYTKVIHECQQRMVADHLQFLHSECHSIIQQERKNDMANMYVLLRAVSSGLPHMIEELQKHIHDEGLRATSNLTQEHMPTLFVESVLEVHGKFVQLINTVLNGDQHFMSALDKALTSVVNYREPKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDKLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIRNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAESSFSLNMSFSSKRTKFKITTSMQKDTPQELEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA elob_mouse Elongin-B Elob Elongin 18 kDa subunit RNA polymerase II transcription factor SIII subunit B SIII p18 Tceb2 Transcription elongation factor B polypeptide 2 protein protein mouse Mus musculus Mouse MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPEEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALRIEPFSSPPELPDVMKPQDSGGSANEQAVQ eloc_mouse Elongin-C Eloc Elongin 15 kDa subunit RNA polymerase II transcription factor SIII subunit C SIII p15 Stromal membrane-associated protein SMAP1B homolog Tceb1 Transcription elongation factor B polypeptide 1 protein protein mouse Mus musculus Mouse MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC vhl_mouse von Hippel-Lindau disease tumor suppressor pVHL Vhlh Vhl protein protein mouse Mus musculus Mouse MPRKAASPEEAAGEPGPEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPLWLNFDGEPQPYPILPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDYPSVRKDIQRLSQEHLESQHLEEEP socs3_mouse Suppressor of cytokine signaling 3 Cytokine-inducible SH2 protein 3 Protein EF-10 Cis3 Cish3 Socs3 protein protein mouse Mus musculus Mouse MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGTPSFSLPPTEPSSEVPEQPPAQALPGSTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL cul5_mouse Cullin-5 Cul5 protein protein mouse Mus musculus Mouse MATSNLLKNKGSLQFEDKWDFMHPIVLKLLRQESVTKQQWFDLFSDVHAVCLWDDKGSSKIHQALKEDILEFIKQAQARVLSHQDDTALLKAYIVEWRKFFTQCDILPKPFCQLEVTLLGKQSSNKKSNMEDSIVRKLMLDTWNESIFSNIKNRLQDSAMKLVHAERLGEAFDSQLVIGVRESYVNLCSNPEDKLQIYRDNFEKAYLDSTERFYRTQAPSYLQQNGVQNYMKYADAKLKEEEKRALRYLETRRECNSVEALMECCVNALVTSFKETILAECQGMIKRNETEKLHLMFSLMDKVPNGIEPMLKDLEEHIISAGLADMVAAAETITTDSEKYVEQLLTLFNRFSKLVKEAFQDDPRFLTARDKAYKAVVNDATIFKLELPLKQKGVGLKTQPESKCPELLANYCDMLLRKTPLSKKLTSEEIEAKLKEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISADSEIEENMVEWLREVGMPADYVNKLARMFQDIKVSEDLNQAFKEMHKNNKLALPADSVNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATELPDAELRRTLWSLVAFPKLKRQVLLYDPQVNSPKDFTEGTLFSVNQDFSLIKNAKVQKRGKINLIGRLQLTTERMREEENEGIVQLRILRTQEAIIQIMKMRKKISNAQLQTELVEILKNMFLPQKKMIKEQMEWLIEHRYIRRDEADINTFIYMA rbx2_mouse RING-box protein 2 RING finger protein 7 Sensitive to apoptosis gene protein Rbx2 Sag Rnf7 protein protein mouse Mus musculus Mouse MADVEDGEEPCVLSSHSGSAGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK vhl-cul2-1 917153 rbx1_human 917157 unspecified role unspecified role prey prey cul2_human 917158 unspecified role unspecified role prey prey vhl_human 917159 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false elob_human 917160 unspecified role unspecified role prey prey eloc_human 917161 unspecified role unspecified role prey prey association association false false false Fig 2A and Fig 5E Coimmunoprecipitation of HEK293T cells stably transfected with VHL-Flag tagged construct showed association with Cul2, Rbx1, Elongin B and Elongin C; region 178-181 (LDIV) is necessary for binding Cul2 and Rbx1 and not Elongin B and C socs3-cul5-1 917153 elob_human 917160 unspecified role unspecified role prey prey rbx2_human 917162 unspecified role unspecified role prey prey cul5_human 917163 unspecified role unspecified role prey prey eloc_human 917161 unspecified role unspecified role prey prey socs3_human 917164 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false association association false false false Fig 2B Coimmunoprecipitation of HEK293T cells stably transfected with SOCS3-Flag tagged construct showed association with Cul5, Rbx2, Elongin B and Elongin C spsb1-cul5 917153 eloc_human 917161 unspecified role unspecified role prey prey spsb1_human 917165 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false elob_human 917160 unspecified role unspecified role prey prey rbx2_human 917162 unspecified role unspecified role prey prey cul5_human 917163 unspecified role unspecified role prey prey association association false false false Fig 2c Coimmunoprecipitation of HEK293T cells stably transfected with SSB1-Flag tagged construct showed association with Cul5, Rbx2, Elongin B and Elongin C spsb2-cul5 917153 cul5_human 917163 unspecified role unspecified role prey prey elob_human 917160 unspecified role unspecified role prey prey eloc_human 917161 unspecified role unspecified role prey prey rbx2_human 917162 unspecified role unspecified role prey prey spsb2_human 917166 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false association association false false false Fig 2B Coimmunoprecipitation of HEK293T cells stably transfected with SSB2-Flag tagged construct showed association with Cul5, Rbx2, Elongin B and Elongin C rab40c-cul5 917153 eloc_human 917161 unspecified role unspecified role prey prey cul5_human 917163 unspecified role unspecified role prey prey rbx2_human 917162 unspecified role unspecified role prey prey rb40c_human 917167 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false elob_human 917160 unspecified role unspecified role prey prey association association false false false Fig 2B Coimmunoprecipitation of HEK293T cells stably transfected with RAR3-Flag tagged construct showed association with Cul5, Rbx2, Elongin B and Elongin C wsb1-cul5 917153 rbx2_human 917162 unspecified role unspecified role prey prey eloc_human 917161 unspecified role unspecified role prey prey wsb1_mouse 917168 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false elob_human 917160 unspecified role unspecified role prey prey cul5_human 917163 unspecified role unspecified role prey prey association association false false false Fig 2B Coimmunoprecipitation of HEK293T cells stably transfected with Wsb1-Flag tagged construct showed association with Cul5, Rbx2, Elongin B and Elongin C lrrc41-cul5 917153 elob_human 917160 unspecified role unspecified role prey prey cul5_human 917163 unspecified role unspecified role prey prey rbx2_human 917162 unspecified role unspecified role prey prey lrc41_mouse 917169 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false eloc_human 917161 unspecified role unspecified role prey prey association association false false false Fig 2B Coimmunoprecipitation of HEK293T cells stably transfected with Muf1-Flag tagged construct showed association with Cul5, Rbx2, Elongin B and Elongin C socs1-cul5-1 917153 rbx2_human 917162 unspecified role unspecified role prey prey elob_human 917160 unspecified role unspecified role prey prey cul5_human 917163 unspecified role unspecified role prey prey eloc_human 917161 unspecified role unspecified role prey prey socs1_mouse 917170 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false association association false false false Fig 3F Coimmunoprecipitation of HEK293T cells stably transfected with Socs1-Flag tagged construct showed association with Cul5, Rbx2, Elongin B and Elongin C; socs1 195IPLN198-LPLN mutation disrupt interaction with Cul5 and Rbx2 and not Elongin B or C cul2-fem1b 917153 vhl_human 917159 unspecified role unspecified role prey prey llr1_human 917171 unspecified role unspecified role prey prey eloc_human 917161 unspecified role unspecified role prey prey rbx1_human 917157 unspecified role unspecified role prey prey fem1b_human 917172 unspecified role unspecified role prey prey cul2_human 917158 unspecified role unspecified role bait bait c-term C-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false elob_human 917160 unspecified role unspecified role prey prey association association false false false Fig 5A Coimmunoprecipitation of HEK293T cells stably transfected with Cul2-Flag tagged ppil5-cul2 917153 llr1_human 917171 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false binding site binding site required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false eloc_human 917161 unspecified role unspecified role prey prey rbx1_human 917157 unspecified role unspecified role prey prey elob_human 917160 unspecified role unspecified role prey prey cul2_human 917158 unspecified role unspecified role prey prey association association false false false Fig 5C, Fig 5E Coimmunoprecipitation of HEK293T cells stably transfected with LRR1-Flag tagged construct; 341HIIP344-AAAA mutation disrupt interaction with Cul2 and Rbx1 and not Elongin B or C fem1b-cul2 917153 fem1b_human 917172 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false eloc_human 917161 unspecified role unspecified role prey prey rbx1_human 917157 unspecified role unspecified role prey prey elob_human 917160 unspecified role unspecified role prey prey cul2_human 917158 unspecified role unspecified role prey prey association association false false false Fig 5B Coimmunoprecipitation of HEK293T cells stably transfected with Fem1B-Flag tagged construct vhl-cul2-2 917154 elob_human 917160 unspecified role unspecified role prey prey rbx1_human 917157 unspecified role unspecified role prey prey vhl_human 917159 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false eloc_human 917161 unspecified role unspecified role prey prey cul2_human 917158 unspecified role unspecified role prey prey association association false false false Fig 2C and Fig 5F Coimmunoprecipitation of HEK293T cells stably transfected with VHL-Flag tagged construct showed association with Cul2, Rbx1, Elongin B and Elongin C; region 178-181 (LDIV) is necessary for binding Cul2 and Rbx1 and not Elongin B and C socs3-cul5-2 917154 cul5_human 917163 unspecified role unspecified role prey prey rbx2_human 917162 unspecified role unspecified role prey prey socs3_human 917164 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false eloc_human 917161 unspecified role unspecified role prey prey elob_human 917160 unspecified role unspecified role prey prey association association false false false Fig 2c Coimmunoprecipitation of HEK293T cells stably transfected with SOCS3-Flag tagged construct showed association with Cul5, Rbx2, Elongin B and Elongin C spsb1-cul5-1 917154 cul5_human 917163 unspecified role unspecified role prey prey eloc_human 917161 unspecified role unspecified role prey prey rbx2_human 917162 unspecified role unspecified role prey prey spsb1_human 917165 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false elob_human 917160 unspecified role unspecified role prey prey association association false false false Fig 2C and Fig 3D Coimmunoprecipitation of HEK293T cells stably transfected with SSB1-Flag tagged construct showed association with Cul5, Rbx2, Elongin B and Elongin C; 212LPLP215-AAAA mutation disrupted interaction with Cul5 and Rbx2 and not Elongin B or C spsb2-cul5-1 917154 rbx2_human 917162 unspecified role unspecified role prey prey cul5_human 917163 unspecified role unspecified role prey prey eloc_human 917161 unspecified role unspecified role prey prey elob_human 917160 unspecified role unspecified role prey prey spsb2_human 917166 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false association association false false false Fig 2C Coimmunoprecipitation of HEK293T cells stably transfected with SSB2-Flag tagged construct showed association with Cul5, Rbx2, Elongin B and Elongin C rab40c-cul5-1 917154 rb40c_human 917167 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false eloc_human 917161 unspecified role unspecified role prey prey rbx2_human 917162 unspecified role unspecified role prey prey cul5_human 917163 unspecified role unspecified role prey prey elob_human 917160 unspecified role unspecified role prey prey direct interaction direct interaction false false false Figs. 2C, 3B Coimmunoprecipitation of HEK293T cells stably transfected with RAR3-Flag tagged construct showed association with Cul5, Rbx2, Elongin B and Elongin C; 212LPLP215-AAAA mutation disrupted interaction with Cul5 and Rbx2 and not Elongin B or C wsb1-cul5-1 917154 rbx2_human 917162 unspecified role unspecified role prey prey elob_human 917160 unspecified role unspecified role prey prey eloc_human 917161 unspecified role unspecified role prey prey wsb1_mouse 917168 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false cul5_human 917163 unspecified role unspecified role prey prey association association false false false Fig 2C Coimmunoprecipitation of HEK293T cells stably transfected with Wsb1-Flag tagged construct showed association with Cul5, Rbx2, Elongin B and Elongin C lrrc41-cul5-1 917154 lrc41_mouse 917169 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false elob_human 917160 unspecified role unspecified role prey prey cul5_human 917163 unspecified role unspecified role prey prey eloc_human 917161 unspecified role unspecified role prey prey rbx2_human 917162 unspecified role unspecified role prey prey association association false false false Fig 5C Coimmunoprecipitation of HEK293T cells stably transfected with Muf1-Flag tagged construct showed association with Cul5, Rbx2, Elongin B and Elongin C socs1-cul5 917154 eloc_human 917161 unspecified role unspecified role prey prey socs1_mouse 917170 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false cul5_human 917163 unspecified role unspecified role prey prey elob_human 917160 unspecified role unspecified role prey prey rbx2_human 917162 unspecified role unspecified role prey prey association association false false false Fig 3G Coimmunoprecipitation of HEK293T cells stably transfected with Socs1-Flag tagged construct showed association with Cul5, Rbx2, Elongin B and Elongin C; socs1 195IPLN198-LPLN mutation disrupt interaction with Cul5 and Rbx2 and not Elongin B or C ppil5-cul2-1 917154 elob_human 917160 unspecified role unspecified role prey prey eloc_human 917161 unspecified role unspecified role prey prey cul2_human 917158 unspecified role unspecified role prey prey llr1_human 917171 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false rbx1_human 917157 unspecified role unspecified role prey prey association association false false false Fig 5C and Fig 5F Coimmunoprecipitation of HEK293T cells stably transfected with LRR1-Flag tagged construct; 341HIIP344-AAAA mutation disrupt interaction with Cul2 and Rbx1 and not Elongin B or C fem1b-cul2-1 917154 eloc_human 917161 unspecified role unspecified role prey prey elob_human 917160 unspecified role unspecified role prey prey fem1b_human 917172 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false cul2_human 917158 unspecified role unspecified role prey prey rbx1_human 917157 unspecified role unspecified role prey prey association association false false false Fig 5C Coimmunoprecipitation of HEK293T cells stably transfected with Fem1B-Flag tagged construct spsb4-cul5 917154 rbx2_human 917162 unspecified role unspecified role prey prey eloc_human 917161 unspecified role unspecified role prey prey elob_human 917160 unspecified role unspecified role prey prey cul5_human 917163 unspecified role unspecified role prey prey spsb4_human 917173 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false association association false false false Fig 5E Coimmunoprecipitation of HEK293T cells stably transfected with SSb4-Flag tagged construct; 246-273 mutation disrupt interaction with Cul5 and Rbx2 and not Elongin B or C vhl-cul2-4 917155 eloc_human 917161 unspecified role unspecified role prey prey cul2_human 917158 unspecified role unspecified role prey prey elob_human 917160 unspecified role unspecified role prey prey rbx1_human 917157 unspecified role unspecified role prey prey vhl_human 917159 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false association association false false false Fig 4B vhlm1-cul5-1 917155 n/a 917162 unspecified role unspecified role prey prey n/a 917163 unspecified role unspecified role prey prey elob_human 917160 unspecified role unspecified role prey prey eloc_human 917161 unspecified role unspecified role prey prey n/a 917174 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 4B vhlm2-cul5-1 917155 n/a 917163 unspecified role unspecified role prey prey n/a 917175 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 917162 unspecified role unspecified role prey prey eloc_human 917161 unspecified role unspecified role prey prey elob_human 917160 unspecified role unspecified role prey prey association association false false false Fig 4B vhl-cul2-3 RAW264.7 cells extract was subjected to immunoprecipitation with anti-VHL 917156 rbx1_mouse 917176 unspecified role unspecified role prey prey cul2_mouse 917177 unspecified role unspecified role prey prey elob_mouse 917178 unspecified role unspecified role prey prey eloc_mouse 917179 unspecified role unspecified role prey prey vhl_mouse 917180 unspecified role unspecified role bait bait association association false false false Fig 2D Lipopolysaccharide MG132 socs3-cul5 RAW264.7 cells extract was subjected to immunoprecipitation with anti-SOCS3 917156 elob_mouse 917178 unspecified role unspecified role prey prey socs3_mouse 917181 unspecified role unspecified role bait bait eloc_mouse 917179 unspecified role unspecified role prey prey cul5_mouse 917182 unspecified role unspecified role prey prey rbx2_mouse 917183 unspecified role unspecified role prey prey association association false false false Fig 2D Lipopolysaccharide