IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ siegers-1999-1 Compartmentation of protein folding in vivo: sequestration of non-native polypeptide by the chaperonin-GimC system. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Siegers K., Waldmann T., Leroux MR., Grein K., Shevchenko A., Schiebel E., Hartl FU. uhartl@biochem.mpg.de Actin was detected using an anti-mouse actin monoclonal antibody (Boehringer Mannheim). The specificity of this antibody in yeast was not demonstrated in this paper. EMBO J. (0261-4189) 1999 Only protein-protein interactions imex curation siegers-1999-2 Compartmentation of protein folding in vivo: sequestration of non-native polypeptide by the chaperonin-GimC system. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Siegers K., Waldmann T., Leroux MR., Grein K., Shevchenko A., Schiebel E., Hartl FU. uhartl@biochem.mpg.de Actin was detected using an anti-mouse actin monoclonal antibody (Boehringer Mannheim). The specificity of this antibody in yeast was not demonstrated in this paper. EMBO J. (0261-4189) 1999 Only protein-protein interactions imex curation siegers-1999-5 Compartmentation of protein folding in vivo: sequestration of non-native polypeptide by the chaperonin-GimC system. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Siegers K., Waldmann T., Leroux MR., Grein K., Shevchenko A., Schiebel E., Hartl FU. uhartl@biochem.mpg.de Actin was detected using an anti-mouse actin monoclonal antibody (Boehringer Mannheim). The specificity of this antibody in yeast was not demonstrated in this paper. EMBO J. (0261-4189) 1999 Only protein-protein interactions imex curation siegers-1999-3 Compartmentation of protein folding in vivo: sequestration of non-native polypeptide by the chaperonin-GimC system. in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Siegers K., Waldmann T., Leroux MR., Grein K., Shevchenko A., Schiebel E., Hartl FU. uhartl@biochem.mpg.de Actin was detected using an anti-mouse actin monoclonal antibody (Boehringer Mannheim). The specificity of this antibody in yeast was not demonstrated in this paper. EMBO J. (0261-4189) 1999 Only protein-protein interactions imex curation siegers-1999-4 Compartmentation of protein folding in vivo: sequestration of non-native polypeptide by the chaperonin-GimC system. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Siegers K., Waldmann T., Leroux MR., Grein K., Shevchenko A., Schiebel E., Hartl FU. uhartl@biochem.mpg.de Actin was detected using an anti-mouse actin monoclonal antibody (Boehringer Mannheim). The specificity of this antibody in yeast was not demonstrated in this paper. EMBO J. (0261-4189) 1999 Only protein-protein interactions imex curation siegers-1999-6 Compartmentation of protein folding in vivo: sequestration of non-native polypeptide by the chaperonin-GimC system. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Siegers K., Waldmann T., Leroux MR., Grein K., Shevchenko A., Schiebel E., Hartl FU. uhartl@biochem.mpg.de Actin was detected using an anti-mouse actin monoclonal antibody (Boehringer Mannheim). The specificity of this antibody in yeast was not demonstrated in this paper. EMBO J. (0261-4189) 1999 Only protein-protein interactions imex curation tcpa_yeast T-complex protein 1 subunit alpha TCP1 CCT1 YDR212W YD8142.13 YD8142B.04 CCT-alpha protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQLFNNSRSDTLFLGGEKISGDDIRNQNVLATMAVANVVKSSLGPVGLDKMLVDDIGDFTVTNDGATILSLLDVQHPAGKILVELAQQQDREIGDGTTSVVIIASELLKRANELVKNKIHPTTIITGFRVALREAIRFINEVLSTSVDTLGKETLINIAKTSMSSKIIGADSDFFSNMVVDALLAVKTQNSKGEIKYPVKAVNVLKAHGKSATESLLVPGYALNCTVASQAMPKRIAGGNVKIACLDLNLQKARMAMGVQINIDDPEQLEQIRKREAGIVLERVKKIIDAGAQVVLTTKGIDDLCLKEFVEAKIMGVRRCKKEDLRRIARATGATLVSSMSNLEGEETFESSYLGLCDEVVQAKFSDDECILIKGTSKHSSSSIILRGANDYSLDEMERSLHDSLSVVKRTLESGNVVPGGGCVEAALNIYLDNFATTVGSREQLAIAEFAAALLIIPKTLAVNAAKDSSELVAKLRSYHAASQMAKPEDVKRRSYRNYGLDLIRGKIVDEIHAGVLEPTISKVKSLKSALEACVAILRIDTMITVDPEPPKEDPHDH 02C625D329359E61 act_yeast Actin ACT1 ABY1 END7 YFL039C protein protein yeast Saccharomyces cerevisiae Baker's yeast MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 87AC19B0B0BC9E71 pfd6_yeast Prefoldin subunit 6 YKE2 PFD6 YLR200W L8167.8 GIM1 Genes involved in microtubule biogenesis protein 1 Gim complex subunit 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVEQSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKLNNTAASTGPGR pfd4_yeast Prefoldin subunit 4 GIM3 PFD4 YNL153C N1761 Genes involved in microtubule biogenesis protein 3 Gim complex subunit 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLDDVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLEDKQRDIDSRLDALKAILYAKFGDNINLER pfd5_yeast Prefoldin subunit 5 GIM5 PFD5 YML094W Genes involved in microtubule biogenesis protein 5 Gim complex subunit 5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSQKIDLTKLNPEQLNAVKQQFDQELQHFTQSLQALTMAKGKFTECIDDIKTVSQAGNEGQKLLVPASASLYIPGKIVDNKKFMVDIGTGYYVEKSAEAAIAFYQKKVDKLNKESVQIQDIIKEKTQYSLSIEAQIRQAAIRQHEAMSKQQQQQQKKESSTA pfd3_yeast Prefoldin subunit 3 PAC10 PFD3 GIM2 YGR078C Genes involved in microtubule biogenesis protein 2 Gim complex subunit 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDTLFNSTEKNARGIPQAPFIENVNEIIKDPSDFELCFNKFQERLSKYKFMQESKLATIKQLKTRIPDLENTLKICQSLRNHSDEGDESDEPILLHYQLNDTLYTKAQVDIPEDRADLKVGLWLGADVMLEYPIDEAIELLKKKLADSEQSLTVSTEDVEFLRENITTMEVNCARLYNWDVQRRQDLKQAQEGTKNLKI tba1_yeast Tubulin alpha-1 chain YML085C TUB1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MREVISINVGQAGCQIGNACWELYSLEHGIKPDGHLEDGLSKPKGGEEGFSTFFHETGYGKFVPRAIYVDLEPNVIDEVRNGPYKDLFHPEQLISGKEDAANNYARGHYTVGREILGDVLDRIRKLADQCDGLQGFLFTHSLGGGTGSGLGSLLLEELSAEYGKKSKLEFAVYPAPQVSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDMCKRNLDIPRPSFANLNNLIAQVVSSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYSPVLSKSKAFHESNSVSEITNACFEPGNQMVKCDPRDGKYMATCLLYRGDVVTRDVQRAVEQVKNKKTVQLVDWCPTGFKIGICYEPPTATPNSQLATVDRAVCMLSNTTSIAEAWKRIDRKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALERDYIEVGADSYAEEEEF E263B49440F71889 ch60_ecoli Chaperonin GroEL groEL 60 kDa chaperonin Chaperonin-60 GroEL protein groL mopA JW4103 b4143 protein protein ecoli Escherichia coli (strain K12) MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGIDKAVTAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIATLTGGTVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVAGGGVALIRVASKLADLRGQNEDQNVGIKVALRAMEAPLRQIVLNCGEEPSVVANTVKGGDGNYGYNAATEEYGNMIDMGILDPTKVTRSALQYAASVAGLMITTECMVTDLPKNDAADLGAAGGMGGMGGMGGMM CD3A0FB505F74AD1 pfd1_yeast Prefoldin subunit 1 PFD1 GIM6 J0488 YJL179W Genes involved in microtubule biogenesis protein 6 Gim complex subunit 6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQIAQEMTVSLRNARTQLDMVNQQLAYLDRQEKLAELTKKELESYPTDKVWRSCGKSFILQDKSKYVNDLSHDETVLLDQRKTLKIKKNYLETTVEKTIDNLKALMKN pfd2_yeast Prefoldin subunit 2 GIM4 PFD2 Genes involved in microtubule biogenesis protein 4 Gim complex subunit 4 YEL003W protein protein yeast Saccharomyces cerevisiae Baker's yeast MEQRNNVFQAKYNEYKQILEELQTKIIELGHDKDEHTIVIKTLKDAEPTRKCYRMIGGALVESDVQTSLPILETKKENIEGTISKMKETLIQTAKEFEKWKKDNKIQVVKN act1-tcp1-1 Interaction between TCP1 and Actin identified by coimmunoprecipitation 814963 n/a 814969 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 814970 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1B gim1-gim2-2 Interaction of the GIMS complex with actin 814963 n/a 814970 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 814971 unspecified role unspecified role prey prey n/a 814972 unspecified role unspecified role prey prey n/a 814973 unspecified role unspecified role prey prey n/a 814974 unspecified role unspecified role prey prey association association false false false Fig. 4B gim1-gim2-3 Interaction of the GIMS complex with tubulin 814963 n/a 814975 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 814971 unspecified role unspecified role prey prey n/a 814972 unspecified role unspecified role prey prey n/a 814974 unspecified role unspecified role prey prey n/a 814973 unspecified role unspecified role prey prey association association false false false Fig. 4C gim1-gim2-4 Interaction of the GIMS complex with TCP1 814963 n/a 814969 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 814974 unspecified role unspecified role prey prey n/a 814973 unspecified role unspecified role prey prey n/a 814972 unspecified role unspecified role prey prey n/a 814971 unspecified role unspecified role prey prey association association false false false Fig. 4C act1-tcp1-2 Interaction between TCP1 and Actin identified by coimmunoprecipitation 814964 n/a 814970 unspecified role unspecified role prey prey n/a 814969 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1C The hetero-oligomeric TRiC complex migrated as a group of bands between 50-60 kDa grol-2 Hetero-oligermerization of GroL 814964 n/a 814976 unspecified role unspecified role neutral component neutral component P0A6F5:p.Asp87Lys Abolishes ATP hydrolysis mutation mutation certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 2B grol-act-3 Binding of E.coli GroL to yeast actin 814964 n/a 814976 unspecified role unspecified role bait bait P0A6F5:p.Asp87Lys Abolishes ATP hydrolysis mutation mutation certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 814970 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Figs. 2B, 2C grol-act-2 Binding of E.coli GroL to yeast actin by coimmunoprecipitation 814965 n/a 814976 unspecified role unspecified role bait bait P0A6F5:p.Asp87Lys Abolishes ATP hydrolysis mutation mutation certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 814970 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Figs. 3 grol-act-4 Binding of E.coli GroL to yeast actin by coimmunoprecipitation 814965 n/a 814976 unspecified role unspecified role bait bait P0A6F5:p.Asp87Lys Abolishes ATP hydrolysis mutation mutation certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 814970 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Fig. 6A grol-act-1 Binding of E.coli GroL to yeast actin 814966 n/a 814970 unspecified role unspecified role neutral component neutral component region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 814976 unspecified role unspecified role neutral component neutral component P0A6F5:p.Asp87Lys Abolishes ATP hydrolysis mutation mutation certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Figs. 2B, 2C gim1-gim2-1 Purification of the GIMS complex 814967 n/a 814977 unspecified role unspecified role prey prey n/a 814972 unspecified role unspecified role prey prey n/a 814973 unspecified role unspecified role prey prey n/a 814971 unspecified role unspecified role prey prey n/a 814978 unspecified role unspecified role prey prey n/a 814974 unspecified role unspecified role bait bait region protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 4A grol-act-5 Binding of E.coli GroL to yeast actin 814968 n/a 814976 unspecified role unspecified role neutral component neutral component P0A6F5:p.Asp87Lys Abolishes ATP hydrolysis mutation mutation certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 814970 unspecified role unspecified role neutral component neutral component region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Figs. 3B, 6A