IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ling-1995-1 Human IL-12 p40 homodimer binds to the IL-12 receptor but does not mediate biologic activity. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight identificat confirmation by molecular weight weight identificat Ling P., Gately MK., Gubler U., Stern AS., Lin P., Hollfelder K., Su C., Pan YC., Hakimi J. The co-immunoprecipitated complexes were pulled down using non specific antibodies to IL-12. These proteins were reduced and further separated by non-reducing gel electrophoresis, where they appeared as 35kDa nad 40kDa bands which bound to an anti-IL-12 Ab. J. Immunol. (0022-1767) 1995 Only protein-protein interactions imex curation ling-1995-2 Human IL-12 p40 homodimer binds to the IL-12 receptor but does not mediate biologic activity. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 chromatography chromatography technology column chromatography chromatography weight silver stain molecular weight estimation by silver staining weight silver stain Ling P., Gately MK., Gubler U., Stern AS., Lin P., Hollfelder K., Su C., Pan YC., Hakimi J. The co-immunoprecipitated complexes were pulled down using non specific antibodies to IL-12. These proteins were reduced and further separated by non-reducing gel electrophoresis, where they appeared as 35kDa nad 40kDa bands which bound to an anti-IL-12 Ab. J. Immunol. (0022-1767) 1995 Only protein-protein interactions imex curation il12b_human Interleukin-12 subunit beta IL12B NKSF2 IL-12 subunit p40 Cytotoxic lymphocyte maturation factor 40 kDa subunit NK cell stimulatory factor chain 2 protein protein human Homo sapiens Human MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS il12a_human Interleukin-12 subunit alpha IL12A NKSF1 IL-12 subunit p35 Cytotoxic lymphocyte maturation factor 35 kDa subunit NK cell stimulatory factor chain 1 protein protein human Homo sapiens Human MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS il12a-il12b-2 856249 n/a 856251 unspecified role unspecified role prey prey n/a 856252 unspecified role unspecified role bait bait physical association physical association false false false 2 il12b-il12b 856249 n/a 856251 unspecified role unspecified role prey prey n/a 856251 unspecified role unspecified role bait bait physical association physical association false false false 2 il12b-il12b-1 856250 n/a 856251 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 physical association physical association false false false 6, 5, table 1 80Kda dimer.