IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ martin-2010-1 Construction of a large extracellular protein interaction network and its resolution by spatiotemporal expression profiling. in vitro In vitro solid phase assay solid phase assay tag visualisation tag visualisation Martin S, S�llner C, Charoensawan V, Adryan B, Thisse B, Thisse C, Teichmann S, Wright GJ. AVEXIS classifications were used for mapping confidence. The classifications are: A - Homophilic interaction seen in both the primary and validation screens. B - Homophilic interaction positive in either the primary or validation screen. C - Heterophilic interaction positive in both bait-prey orientations in the primary and validation screens. Positive 4 out of 4 times tested. D - Heterophilic interaction positive in both bait-prey orientations in either the primary or validation screens. Positive 3 out of 4 times tested. E - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; positive in both orientations in the validation screen. Positive 3 out of 3 times tested. F - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; also positive in one orientation only in validation screen (both orientations tested) but in different orientation to the primary screen. Positive 2 out of 3 times tested. G - Heterophilic interaction positive in one bait-prey orientation only in both the primary and validation screen. Positive 2 out of 4 times tested. H - Heterophilic interaction negative in both bait-prey orientations in the primary screen but positive in both orientations in the validation screen. Positive 2 out of 4 times tested. I - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; positive in only the same orientation in the validation screen (both orientations tested). Positive 2 out of 3 times tested. J - Heterophilic interaction negative in one bait-prey orientation in the primary screen but other orientation not tested; positive in both orientations in the validation screen. Positive 2 out of 3 times tested. Interactions were considered as high confidence when identified in the first screen and detected in both bait-prey orientations (classes A, C, D, E and F). 2009-02-25: GJ Wright, The Wellcome Trust Sanger Institute, Hinxton, UK. http://www.sanger.ac.uk/arnie AVEXIS a novel solid phase assay (MI:0892) to detect surface interactions was used. Ectodomains bound to rat CD4 domains 3+4 were expressed in HeLa-293E cells as a monomeric biotinylated bait, which could be captured on streptavidin-coated microtitre plates, and a pentamerised prey tagged with beta-lactamase to allow detection. The nucleotide sequence accession numbers provided in the Table S1 were used to determine the UniProtKB Accession numbers. gw2@sanger.ac.uk 2009 Only protein-protein interactions imex curation b0clv6_danre cadm3 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MSGMRARQTLAFPSFQRAALRALAAFTMILATSVRSNYVYDDDPFQPVTQDETVAVGGVVTLTCGVKENDNSSLQWSNTAQQTLYFGEKRALRDNRIQLVKSTATELIITIGDVQLSDDGEYTCSIFTMPVRTARATVTVLGVPGKPVITGFEGAVQEGGKVTLTCTSSGSKPPAKLHWYRDHVEIQGRPDVVESNPNEPTYTVTSELTLSVSRDDNDALIACAVDHPSIANGDKRTEQPLNVLFSPRVSIHPESDLPREGEKFYLQCVGNGNPEPNAFVWRRKEGELPPLAKVDGAFLRFESLNKSDNGVYECQADNGIGMGDVAHTLLVQEAGENAADPTAMSTGSGVDHAVIGGVVAVIVFIMLCLLLVLGRYLIRHKGTYLTHEAKGSDDAPDADTAIINAEGGHSGVDDKKEYFI b0cly0_danre sc:d0647 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MMASRGILWNLWMLACFGQCFGQDLQVPDLPPLAQGQSVTFTPENPPSTWRQASWLNNADTSIITAASSAVVVNPDYEERVRFDPNTLALELWNLKLNDSGTYKLTVLTSPGVTITAETSLHVLEKVNNVKLIGPEKPLFETESSANITSEGGGTITSVQWMKDNSPLSSSSRIIFSSDNRSVSISPVERSDTGEYQCTYSNPVSSDTAKLTLIINYGPDGVSIDGPDVVNLGVPVSLSCSANSEPSASFSWTFNGSDTGVTTDKYTIDKTDFRNSGEYICTASNNVTNKEEFKKHALIVQEGPSGGGGLSAGAIAGIVIGVLVAVGGICGLIVYLTKTKKIPKLSHRSNGQASGAAQRGQDAELNYADISHFQKTSGERVVLGDMDEPRTEYAEVRHGSKLRAPPPPYGSQVSNPPPVRRDSQPLLSPQEDGAHV q6u7i4_danre l1cama nadl1.2 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MPATSQKQQVSSRGRCTALLLPLLLLAVALKPGNTTINIPSRYKIRDLKSPPVITAQPKSVTTFSADDITLTCDATGNPPPTFRWVKDGVEFDPSKDPDLSVSRDSGTFSLTAKDGPIHQYQGRYNCYASNELGTAVSNEARIVTENTPTLQTEKIITKKVEEGESVVLPCNPPNGTVAPVIHWMDKKLRHIQQNERVIQGRDGNLYFPHATVADSRDDYTCNIQFPSARVIKLKEPIKLTVSSSNSVVRNRRPQMMRPTGSSSSYLVLSGQNLELECIVQGLPSPSIQWIRKDGVLSESRTTKDSNDRVLRFQNISETDGGEYQCTATNPQGMSTHTYRVTVEAAPYWIKEPKSQLYAPGETVKLECKADGIPKPEVTWSINGILLSDIDPDPRRSVKHGVLTLKNVELSDTAVFQCKAASKHGSVLINAYVYVIELPPQILTEDGLMYSVAEGQTTELACETFGSPRPNVTWEGESWGALVANQRMIQLSDGSLQISNASLNDSGQYTCTVNNSKITITAELDVLNKTVIVKPPLALRIQRGKPATLTCEYQVDSRQDLPQVQWRKNMQKLTESSDSDKYMIDESTLIIPEVEEEDEGIYTCEVITTLDMAKASGSITIVDRPDPPSLIQMTEPKERRVTLSWTPGADHNSPVLEYLIEFEETGSDRKEWEELSRVSCSSQRATLPLKPFISYRFRVIAINEIGKSDPSMVTEAYSTPAAPPDSNPEGVRSDSDEPGTLVITWKEMDRRSFNGPDFHYKVMWRKVLGSGPSWHTKDITSPPFVVTDVGNFSAFDIKVQAVNEMGEGPEPKSIIGYSGEDYPLEAPLDVGLILINSTAIKVTWAAVNRETVRGRLQGYKIYLTYLGPKGQHLRREPKTTFVVTTDSNEEKKVLGDLQPFSHYNLAVSVFNYKGEGPQSESILFFTPEGVPGPPSSLMLDSPSETEMTVHWTPPNQPNGNLIGYILQHQQLDNDASLMQVVKISDPTASHYKLKLDPHSRYRFYLRGYTAIGEGLPIIKDGATTLDPVPPSDISISTGETSVNLTWVSKERQRNVEFFIHYLRKDGPDKWEKSEKVNSTQSFYTLHGLQPGSQYRLKIDFNNTKWEQEIQTAGARVMEVRSGFVTESWFIGLISALVLLLLVLLILCFIKRSKGGKYSVKEKEEGQIDSEARPMNNEAFGEYRSLESDNEEKRTASQPSLCEDSKLCTDDGLDDYANSNSVQTEVIMDESLASQSSGVRDVPDAETQESSPLNPATAISHHGLPNSAALLD b0cm12_danre l1cama nadl1.2 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MPATSQKQQVSSRGRCTALLLPLLLLAVALKPGNTTINIPSRYKIRDLKSPPVITAQPKSVTTFSADDITLTCDATGNPPPTFRWVKDGVEFDPSKDPDLSVSRDSGTFSLTAKDGPIHQYQGRYNCYASNELGTAVSNEARIVTENTPTLQKEKIITKKVEEGESVVLPCNPPNGTVAPVIHWMDKKLRHIQQNERVIQGRDGNLYFSHATVADSRDDYTCNIQFPSARVIKLKEPIKLTVSSSNSVVRNRRPQMMRPTGPSSSYLVLSGQNLELECIVQGLPSPSIQWIRKDGVLSESRTTKDSNDRVLRFQNISETDGGEYQCTATNPQGMSTHTYRVTVEAAPYWIKEPKSQLYAPGETVKLECKADGIPKPEVTWSINGILLSDIDPDPRRSVKHGVLTLKNVELSDTAVFQCKAASKHGSVLINAYVYVIELPPQILTEDGLMYSVAEGQTTELACETFGSPRPNVTWEGESWGALVANQRMIQLSDGSLQISNASLNDSGQYTCTVNNSKITITAELDVLNKTVIVKPPLALRIQRGKPATLTCEYQVDSRQDLPQVQWRKNTQKLTESSDSDKYMIDESTLIIPEVEEEDEGTYTCEVITTLDMAKASGSITIVDRPDPPSLIQMTEPKERRVTLSWTPGADHNSPVLEYLIEFEETGSDRKEWEELSRVSGSSQRATLPLKPFISYHFRVIAINEIGKSDPSMVTEAYSTPAAPPDSNPEGVRSDSDEPGTLVITWKEMDRRSFNGPDFHYKVMWRKVLGSGPSWHTKDITSPPFVVTDVGNFSAFDIKVQAVNEMGEGPEPKSIIGYSGEDYPLEAPLDVGLILINSTAIKVTWAAVNRETVRGRLQGYKIYLTYLGPKGQHLRREPKTTFVVTTDSNEEKKVLGDLQPFSHYNLAVSVFNYKGEGPQSESILFFTPEGVPGPPSSLMLDSPSETEMTVHWTPPNQPNGNLIGYILQHQQLDNDASLMQVVKISDPTASHYKLKLDPHSRYRFYLRGYTAIGEGLPIIKDGATTLDPVPPSDISISTGETSVNLTWVSKERQRNVEFFIHYLRKDGPDKWEKSEKVNSTQSFYTLHGLQPGSQYRLKIDFNNTKWEQEIQTAGARVMEVKSGFVTESWFIGLISALVLLLLVLLI b0clv3_danre cadm4 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MMMAFSSVWKYWAPLPLLLLLYSHTARGQAVQAENVTVLEGGTAQISCRLQNYDGSIVVIQNPRRQTLFFNGTRALKDDRFQMVLFTPKLVRITLTNVSVSDEGGYFCQLYTDDTHHQVATLSVVVPPEVPSVEVKTEAVEGGEVELTCLSLRSKPPATLRWVRDRREIPGVISQQENGKTVSVSNTIRIPVERKDNRAALSCEASHPALVSQKRVRHYSLDVHFAPTVKIVPPQGILREGDSLSLTCSVTGNPLPRDIQWSRVNDTLPERAEKTGNILHMSRLSQSHNGTYLCQAHNNYGRAADHYTLLVYVSVAQSHPAIAHPNLPSSKEYQDPGAVVETHSAVPFAVIGGILALLVFTVICVLIVTIWCSVRQKGSYLTHEASGLDEHGEVQEAFLNGNDASQGKKEYLL b0clw6_danre pvrl2l si:dkey-225e11.1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MSDFTMINCCLVLAACLLSSQAVWSQRVRVEYEVTAYPNGSVNLRCEFTNSGTTKLTQVSWMFERAENDRQNIAVFHPQYGASFPNKDFEGRVKFTQGSLENPSIRIDKLRMADAGRYICEYATYPSGNEQGTTTLIMLAKPKNSATAIPVRAGTSEVVVATCAAAQGKPEATISWITTITGRYNHTSVPESDGTVTVKSEYRMIPTPVENGKEITCVVNQRTQMEDKVFNLKLVVEYPPTVTIDGYDNNWYMGRTDVYLTCEADANPEPSEISWTVATGQMPSSVRVEENRLLVRKVDETVNTTFVCEVKNRLGTGKKELVALVIGE a1l2d6_danre cd226 zgc:158817 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MVAVQKDYWYFLVLVMLLCFLKGSVQMKAPESSVVLQEGMVLDCLCPWTGQLIMVSWTKTPFAKPIAVYHPQYGTNFGSSYEGRVEFLKSTAMDGSISIMNVTEGDIGQYHCSLQTYPQGSWTKDTFVQKAAITTSTSISIQADTKLVVAENDNLTIMCDLVHDGKIYQVSIEKLDTEEGNSNIIATCEMLEDGVELRNFSNRGLLNCSEDMEVSLHLTNIIKEDGGLYRCNFSTNNGIQSTTVLLTTVPAQDFPGLHHMLYVYIGGGVIGVVALMTLLLTWLNRMKRKKEEYRIKLHPAKRQRNPYDQSCVYDRMKKGTRTRAKDKEIYMNFQIVRAHAKHKR vgfr4_danre Vascular endothelial growth factor receptor kdr-like kdrl flk flk-1 flk1 flka kdr kdra vegfr2 vegfr4 vegr2 Vascular endothelial growth factor receptor 4 Protein-tyrosine kinase receptor flk-1 Fetal liver kinase 1 Kinase insert domain receptor-like Kinase insert domain receptor-A si:ch211-276g21.4 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MTPLKTSVKAFFTLHVLFSCISHGLVEGSRLPDPQLLPDGDTHLQHVGGTLTLICRGSTALHWRLASRNVSSVRIESCEERLHKHCSKLVIHNLRHNDTGIYSCSHKKSSDHEVSTYVFVKDPHHPFVEAYSLPHPLFAYRNDPYFVVPCRTTYPNQNVILETQMNPMADDVKRGVQWDPKKGFTVPLKPYDSYHLITCLTRVDNAEFSSVYLLKRLTMEIKNLAIEPERPRVLVGDTLILNCSAETTYNGRIHFEWEFHKERINRTHHFSTTPVQLAQIMVMSKALIVPNVTMEDKGTYTCTGSIEFKKLQMSTKVIVYEHPFLNVTHNKRKFTSTVEGRRVQFEPRVNAVPAPDRVLWYKDGVAISENSTCYETAGYNLTIKQVRQKDAGIFTIALSNQERGLYRNISYKLEVRVKPKIFEEDVAPAGPQTFRYDQRHKLTCTAFGIPMPNITWFWQPCDPSANLTECKLYTDPLPIENVDDHFPQNPIKDVNSKVGLLKSKNRTISTLVVKTANVSGVYSCTARNELGNRTMRIPFYVDDHPQPFEIEPSTAVAGDDITLTCRGTRYLYDRLTWYDPLGHKVPKDETTLRIEPYTISLSIKLPNVSRNHTLGYECQALKINTNKVVNVTSALTIDERQGPWLMQNLTNQDVNSSSTLTLACLAYGVPAPFITWYKDKTPVTEGPGITLKDDGTLIIERVKKDDEGIYECRASNDGGEAKTSAVITVVGEDGKPNIEVIILVSTGAAATFLWIMLILFIRKLRKPSSADLKTGYLSIIMDPEQMPLDEQCDRLPYDSNKWEFPQDRLRLGKTLGHGAFGKVVEASAFGIDKISTCKTVAVKMLKVGATNNEWRALMSELKILIHIGHHLNVVNLLGACTKRGGPLMIIVEFCKYGNLSNYLRSKRGDFVVYKSQDGKAVRSSSGCDLSELIKRRLESVASTGSSASSGFIEDKSYCDSEEEEEEQEDLYKKVLTLEDLICYSFQVAKGMEFLASRKCIHRDLAARNILLSENNVVKICDFGLARDVYKDPDYVRKGDARLPLKWMAPEAIFDKIYTTQSDVWSFGVLMWEIFSLGASPYPGLHIDEEFCCRLKEGTRMKAPEYSSSEIYQTMLDCWHGEPSQRPTFTELVERLGDLLQASVQQEGKHYIPINTALLTKADPSNQSPTEETSTRPVSLRDSGTAWNIKIRPESVKTFDEVILENGTNKIHEGGQSDSGIGLSSDDLKTLKRLESLARPRSFMSRAMKRKSKESVLLEGEMDKYPPLVPSLSLEDSSLDSEMECHSPPPDYNYVVRYSTPPV q90z69_danre robo3 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MEFRRTLDALVVVFALICLSQGSRPRLEDAAPRIVEHPSDLIVSKGEPATLNCKAEGRPTPMVEWYKDGERVETDREDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGVYVCVARNYLGEAVSRNASLEVAILRDDFRQTPSDVVVAAGEPAVMECIPPRGHPEPTISWKRNNVKVNDKDERITIRGGKLMISNTRKSDAGMYVCVGTNMVGEKDSDPAELVVFERPMFVRRPVNQVVLADDTVDFQCEVQGDPAPTIRWKKEEGELPRGRFEIRADNSLRLTQVKAEDEGSYTCLSENSVGKAEASGSLQVHVPPQIVVRPRDQISAQGRTVTFLCGTKGNPPPAVFWQKEGSQVLLFPSQPPSQSGRFSVSLSGELTITDVHSEDSGYYICQAISVAGSILTKALLEVESTPSDRIPPIIRQGPANQTLAPGTTAQLQCHVMGNPLPSIQWERHGQRILGIDERISLMENGTLQITALQETDSGAYTCVASSLSGETSWSGVLTVKESGGLSASPVSEPYQLPGPPQKPVVTDVTRNSVTLTWQPNAHEGGAAVTSYIIEAFSQSAGSTWQTVADFVKLEKHTVTGLSPNTIYLFIVRAVNAYGLSDPSPISEPVRTQDVSPTGQGVDHRQVQRELGEMSVQLHEPVLLTASSVKISWNVDRQSQYIQGYRLLYRPVGGSWSQQEVKGATERSAVIANLLKGTEYEIKIRPYFNEFQGLDSRSQTLRTPEEVPSAPPRAVNVATVKLSNSSSISVSWQPPPTDMQNGVIQEYKVWCLGNDSQTRYNINQTVDGSVLSTVLKGLLPGVLYQVEVAAVTSAGVGKHSQPVSVLIKLPAEQPTVTGGGSESEENVSLAEQITDVVKQPAFIAGIGGACWVILMGFSVWIYCRRKKRKELSHYTASFAYTPAVGFPHGESSGLNGRPGMLGANMGNYPWLADSWPTTNLVHNGKDSVNCCTSKHETPERYYNEAGISNYLNQNEKYSADSNEGPIYSTIDPTSEDLRSFTAQYSQHTTPYASTPIMPFTNQAPCSPEQDGSHWMTQPGTSNAQYAQPDRSKTENVKQPKQKLMGKPVKTPSLNWMDALPPPPISGDLEQCDEEDDNELIQDMGSDEEEWCPPLPERSYLMDGMVEDGPVPPPRGEASSPTTSYSHQSTATLTPSPRDDGHFHDIPRLHQLEQPHMTRRLPCGPVPVPRAPSPPLTQSNPNLSANQECPDNTVPHRSAHKRDLSQGAAQSVENISNTTPGRARPSADHTPSGQKSKVKKKASKSAQYRRDILQGDLPPPPEPPPEDQDNCAHVGGFECGQTSLERAGSSNSSMERREQSTPNRKNSAHRRIDADDDLIPYNKPNFLSRGQMSSNCSTTGSSSSRGSTGSRGQGTGRKRNDEMR q9de36_danre slit2 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MFVLKSVVLCALLCGAGAQSCPSQCSCSGTAVDCHGQSLRSVPRNIPRNVERLDLNANNLTKITKADFAGLKNLRVLQLMENKISSIERGAFQDLQELERLRLNRNNLQVLPELLFLGTTKLFRLDLSENQIQGIPRKAFRGSTEIKNLQLDYNQISCIEDGAFRALGDLEVLTLNNNNISRLSVASFNHMPKLRTFRLHSNNLLCDCNVAWLSDWLRQRPRLGLYTQCMAPPSLRGHNIAEVQKKEFMCTGPQSHSSCSVLQCPELCTCSNNVVDCRGKGLTEIPTNLPETITEIRLEQNSIKIIPAGAFAPYKRLRRIDLSNNQITELASDSFQGLRSLNSLVLYGNKITELPKGLFDGLFSLQLLLLNANKINCLRVDSFQDLQNLNLLSLYDNKLQTIAKGTFSSLRAIQTLHLAQNPFMCDCHLKWLADYLQDNPIETSGARCTSPRRLANKRIGQIKSKKFRCSGVEDYRSKLGGDCFADLACPEKCRCEGTTVDCSGQKLTKIPDHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINLSNNKITDIEEGTFEGASGVNELILTSNRLEGVHYSMLKGLGGLRTLMLRSNRISCVNNGSFTGLSSVRLLSLYDNLITSMSPGAFDTLHSLSTLNLLANPFNCNCHLAWLGEWLRKKRIVTGNPRCQSPYFLKEIPIQDVAVQDFACEEGNDENSCSPLARCPAECSCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNEFTQVPLELSNYKHLTLIDLSNNQISTLSNHSFSNMSELLTLILSYNRLRCIPAKAFDGLKSLRLLSLHGNDIAVIPDGAFKDLSSLSHLALGANPLYCDCHMQWLSDWVKSGYKEPGIARCTGPGDMTDKLLLTTPSKKFTCTGPVDVSILAKCNPCLSNPCKNDGTCSNHPVDFYRCTCPYGFKGQDCEEPIHACISNPCQNGGTCHLKDGEENTHWCVCPEGFEGDECEINIDDCEDNDCENNSTCVDGINNYTCLCSPEYTGELCEDKLDFCASELNLCQHDSKCILTAKGFMCECTPGYTGEHCEVDFDDCEDNKCKNGAQCIDAVNGYTCVCPEGYSGLFCEFSPPMVLPRTSPCDHYDCANGAQCVVKDTDPVCQCLPGYEGVHCERLVSVNFINRESFLQIPSNLITEQANISLQIATDEDNGVLLYKGDNEHIAVELYRGRLRVSYDSGSYPPSAIYSVETINDGSFHVVELVAKDQSLSLSIDGGSPKSINTANSPSPVPSPAPLYLGGLPQQSGLASLRQGSGRNGSSFHGCIRNLYINDQLQDLTQFLLQEGVVPGCQPCQRSMCAHGQCHATGQSSFSCECEAGWTGPLCDQQVNNPCDGNKCIHGSCMAINSYSYSCRCLPGFAGVLCDEEEQLSPCQYIACKYGRCRVSGLGKAYCECNSGYTGQSCDREMACRGERVRDHYQTQQGYAACQSTEKVSRLECRGSCGDGTSCCAPLRSKRRKYTFQCTDGSSFVQEVEKVVKCGCTKCPS a8bb35_danre lrrtm4l2 sc:d0340 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MGPLLWEGCLSCFLLHASVLLLLSKGERMCPVSCRCEGKIVYCESGGFQDVPENISLGCQGLSLRYNSLLLLLPYQFAHLNQLVWLYLDHNSISTVDRLAFQGLRRLKELILSSNKIAQLQNGTFETVPNLRNLDLSYNQMQDLVPGHFHGLRKLQNLHLRSNNIRSIPVRTFMECRSLEFLDLGYNRLRTITRTTFLGLLRLTELHLEHNQFSRINFFLFPRLLNLQALYLQWNRIRTVVQGSPWTWHTLQKLDLSGNEIQILDPAIFRCLPNLHTLNLESNKISNVSLEVVSSWISISTINLAGNIWDCSSSICPLVSWLRNFRGTRDASIICSTPKSLQGERVMDAVRNNSVCEEMFTVEPTTELTLLLTTTTTTLYVTKPPTTTTTTPRTTTRQLSQVTHIQRLTPKVLLPVRPEKEFLTVTPSSLPFTPEPEFEHMTFHK a8bbh0_danre Biglycan bgna bgn protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MLSVCVAFLFLCTAHLPIDSSALPFEQKGFWDFGKDIDVKELMMMMDQEEGSAVEPYKPEHPTCPFGCRCELRVVQCSDLGLGYVPYDIPADTLLLDLQSNRITEIREGDFKGLSNLYALVLRYNQISKIHPKAFLPLKRLQKLYISHNLLTSMPKNLPSSLVELRIHDNRIKKVPAFSFSGLHNMHVIEMGRNPLQNSGFEPGAFMGLKLNYLRISEAKLTGVPKDLPGSLHELHLDNNQIQAIELVDLSQYTQLQRLGLGSNQIRHIEHGALSYLTNLRELHLDNNRLPSVPSGLSHMKYLQVVYLHSNNITNVGEDDFCPTGFGLKKVFYNGISLFDNPIRYWEVRPSTFRCVSDQMAVQFAP a4jyf7_danre ntm protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MKNPVFWVVLIGISIALIQQGLPVRSQGESQSDNKQMDNITIRQGETLFLSCSQGDFVTHTAWLNRSSILYAGEDKWSVDPRVSLVTLSQEEFTIKIEDVDVTDEGQYICAVQTSSRPRTTSVHIIVQVPPKIVNLSRDLVVNEGSNVTLMCLANGKPEPAIVWRMKSPSDDSLSSDSEVLDIPFISRYRAGVYECTAANDIAVDTQTVELTVNYAPSVSDGRDVGVTLGQRGVLQCEADAVPEADFEWYRDDRRIFNGLDGIEIEAAGALSRLTFFNVSEADYGNYTCVAINKLGSANTSFVLYVQDGNS q642g9_danre zgc:92901 opcml protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MGITGYFELQWKCLVVVALRLLFLVPAGVPARSGDSYLKDNITVRQGDSAVLKCSMDNKVSRVAWLNRTTILFTGNEKWSLDPRVVLLNTAVNEYSIKILNVNLYDEGPYVCSILTNKKPESTKVHLIVQVPARIVNVSTDVSVNEGSNVSLMCLAIGRPEPSILWKFRSSKGNRIVTEGEYVEMTGITKDMSGSYDCITSNDISPPDVRTVQVTVNYPPVISRARSTGTAVGQKGVLWCEASAVPLADFQWFKGERRILNGFNGVKIENKGKQSMLTFFNVSEEDYGNYTCVAINTLGITNASIILYGPGAIHDVNNAALSPTCSLLLLTLLLTLSLLSKF a0a4w4_danre negr1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MDIMIAVQDACVSGQWLTAIILSLCCFLPSCLPAGQTVDYTTSSESVVSRQGDTALLRCYLLDGISKGAWLNRSSIIYAGNDKWSGDPRVSIVSNVGDKHEYSLQIQKVDVTDEGVYTCSIQSERNLHPKLIQLIVKVPPKIYDISSDITVNEGSNVSLICAASGKPEPKISWRHISPSARKYESGEYLNITGISRDQAGDYECGAENDIASPDTKTVRVTVNFPPAIHEMKSHGVRPGQVALLRCEAAAVPSPVFEWYKGEKRINMGQGIVINNLSSRSVLTVKNMTQDRYGNYTCVAVNRLGTANASVPLNPSNPAMYGSTGGAEVLLACWYLILALSSLVTVY q1l921_danre pvrl2l DKEY-225E11.1-001 si:dkey-225e11.1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish AVWSQRVRVEYEVTAYPNGSVNLRCEFTNSGTTKLTQVSWMFERAENDRQNIAVFHPQYGASFPNKDFEGRVKFTQGSLENPSIRIDKLRMADAGRYICEYATYPSGNEQGTTTLIMLAKPKNSATAIPVRAGTSEVVVATCAAAQGKPEATISWITTITGRYNHTSVPESDGTVTVKSEYRMIPTPVENGKEITCVVNQRTQMEDKVFNLKLVVEYPPTVTIDGYDNNWYMGRTDVYLTCEADANPEPSEISWTVATGQMPSSVRVEENRLLVRKVDETVNTTFVCEVKNRLGTGKKELVALVIESTEDPSSAGVVAGAILGSFLALVLVGALVTVLIMRSRRQQHGYSADGEQSVYGNKTRLFGGKKSSKNGAGANNNGPIYTYRESDPGALTEKCNEFPHMTSSTPTAHDILLSGDLNEAERRKFEAMNDSLEDEEEDERYDRFSGLPPSYQIHRHEDECAPYLDDDMESQRDGSIISRTAIYV The sequence has been withdrawn from uniprot. nect3_danre Nectin-3-like protein nectin3 Nectin cell adhesion molecule 3 Poliovirus receptor-related protein 3-like pvrl3l si:dkey-62a13.5 zgc:113035 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MALTMTAHFLRNNPIQLGLNLRVLLMLSFVSGLVYGSQVIVPPKVNAVLGKNVTLSCRVQVDTNLSLTQSSWERKLPNGWVTLAVYNPMFGISIPPDYERRLSFRSPSALDATIMLEDVGFADIGVYTCKVATFPLGNTQASTTVSVLVEPKVYVSAGSSALIDGGNETTVATCIAERARPPADVSWETNLYGMSEAHMQEDANGTTTTQVHYIWQPSRHAQGHTLTCVVKHPALQSDFRIPYIINVQFAPDILVLGYDGDWYVGRENVQLKCRAKANPPAQHFRWIRLDGEMPNGAERVNNTLVFTRPLQKNDSGVYRCEVANDIGLHSRDIRIRIQDPPSTTTMPPTTPVRLLTADISATAPGNKQRALITSPTLAPLHEGSLGTIVGGAVGGALFLLLLLILAGVYYQRQRRTFRGDYYTKQYHGPSDMQKAPQPHELQQVYSKGSPDTKLKSNQDNGTIYPDKDREEWGDFDRERSPNGRSRALREAGQLNHHNHQNHEHGFHSNHHTGHPQSYSPAHHIQRSSLQPQPRRYPAPQVMSNGSPYLPEDCYDNEYVSHTDGSMISRREWYV q6nzv3_danre zgc:77326 nptnb nptn protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MMLSYSGILALFLVHGNVMLPYVSSQNAGFVKSPMSEVKLTGDAFELYCDVVGNPVPEIQWWYADINRADSFKQLWDGARKRRVSINTASGANVVSVLAISRLTLEDAGIYECRASNDPRRNDMRQNPAITWIRTQATITVLQRPRINASDQEILQPKSSKTSQDPPEPIVLKCNLTNSHSTHQETFWMKNGQEISSSRTQRKHTEFRLNKPRTDDSGEYMCVYTFKSAPNANASIEVKACPEIIGHKRSENKKEGENATLYCKSAGYPHPVWTWRKKVGRDSYMDIDNSTGRFFIVNRENFTELSILDLDIRTDPGEYFCNASNIIGFTNSSTILRVRSHLAPLWPFLGVLAEIIILVVIIVVYEKRKKPDEVFEDDEPVTTMKTNSTNNHKDKNVRQRNTN a4jyd1_danre ncam1b ncam3 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MFPTKAIILVLLFFDNAVSLQVDITPAHGEISVGESRFFLCEVIGGAKEIDWFAPAGEKIEPGRPDISVIHNDETSSTLTIYNAKVDNAGTYRCAASSGDQDAEATVNLKIYQKITFTNVPSPQEFTEGDNAIIVCDVISSPPPTVLWKYKGAKIQFDKDVRFKTLSNNHLQIRGIRKTDEGVYTCEGRIKARGEVDFRSIKVVVNVLPTIRIRQAETNATADMGFSTLLACDPDGFPEPIVTWRRNNAPLESGNKYSFNEDGSEMTVLDVTKLDEGDYTCIAKNKAGESEQELSLKVFVQPKITYLESQTTTEMDEQVALTCEATGDPTPTITWSFGTRVFTEGEQASWTRPEQHKGPDGEVLVRSDARVSSLTLKYPQYTDAGQYLCTARNAIGETVQPVSLEVRYAPKILGSVAVYTWEGNPANISCEVLAHPSDVSITWLRDGFQLPNANTSNIKIHNTPSASYLEVNPESQSDFGNYNCTASNEIGTESREFIMIPADVPSAPSIGEVQPYSSTAQVLFEEPESTGGVPVLKYRAEWRAVGRGKWVQRVYEVKDGLSSVTVTGLKPETDYEVKMSAINGKGEGDSSPSMVFKTEHVREPSPPILEGTLQPKGNSLKVKWIKQDDGGSPITHYLVRYKAREDSEWKPEIRLPSGSEYVMLIGLDWDTEYDVFVVAENQQGKSKPGTLTFRTSSEPTATTDSMEDGPGLNTGVIVGILILVCVLLLLIVDATCCFLNKCGILMCICGKPGQSTKGKDIETGKAAFVQDVSKEPIVEVRTEEE a8bbe6_danre optc protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MAIQRQTSKMLLYLVWILLGFSLGAPPTDLDLEAFGLENYDDPDSWDLHYNYDDEHEEVETVAPPTAVTPPPAVLVPENYVEEMTLPPRPTKSPVPSTLDFKAPGLFGPDTGLGMPTCLLCVCISGSVYCDDSDLTHIPPLPKETTHFYARFNKITEIKAADFINLNQLKRIDLSGNQIGKVNEDAFRSLLQLQDLMMADNNIQALPELPASLKHIDIRNNKLRSSGMHAEAFKEMKELQFLYLSHNKLDYIPVPLPESLRVLHLQNNNIQSITQDTFCNSHDKNYIRKALEDIRLDGNPVDINLYPQAYFCLPRLPVGTP b0cm04_danre Netrin-1 ntn1b protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MIRILVTCVSMVSITSMVSGARGGYGMSMFAAQSSPPDPCYDENGNPRRCIPDFVNSAFGKDVRVSSTCGSPPSRYCVVTEKGEERSRDCNICDATDPKKTHPPAYLTDLNNPHNLTCWQSENYVQYPQNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIFKSMDYGKTWVPFQFYSTQCKKMYNKPSKAAITKQNEQEAICTDSHTDMQPLTGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDIKVTFNRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHASKCVKDREGNLVCECKHNTAGPECDRCKPFHYDRPWQRATAREANECVACHCNLHARRCRFNMELYKLSGRRSGGVCLNCRHNTAGRHCHYCKEGYYRDMSKAISHRRACKACDCHPVGAAGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAAPTSSYSSPDGPTDCDSHCKAPKGKMKVTMKKYCKKDFAVQVHVLKGDKAGEWWKFTINIISVYKQGGHRIRRGDQLLWVRAKDVACKCPKIKPGRKYLLMGSDEEEDSRGQSGVVADRGSLLIPWKDLWARRLRKFQQRDKRGK a8bbb9_danre epyc protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MWGLLVLCVAAASPPRYVRQTELHNYDDNNDVDLDQNVDGDNAYEDYYDGNESEIEITRVDPFEGIESSHSASLEEKEEEELPIKPQLIPPSSGASGTLMGPSAQGGMSVCVLCTCLVGSVYCDDLKLDRVPPLSKDTTHFYSRYNKISRISKSDFANLNKLKKIDLTSNGISRIDDDAFFGLPSLEELILRENNIRQLPALPPSMTLIDVCHNHLGSTGIQREAFKDMPGLLYLYLTDNNIDHIPVPLPESLRSLHLQNNNIQMIHEDTFCNPHDLNYIRNALEDVRLDGNPINLSRTPQAYICLPRIPIG q6nw92_danre igfbp7 zgc:85888 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MLCVLVLALLASASAQRLSRGCGSCDRTQCAPLPAQGCSSGTLRDSCGCCELCAAAEGEFCGGRGVSARRCGSGLECVKPDKKSKSGICVCKSGVPVCGTDGRNYNSGCALRAASARALQEKQPEIRVHNTGRCAQGPEIVTPPGEVWNITGSQVFLSCEAIGVPTPVLTWRKVSGGSEKPVPLPGDKDNLAVQTRGGPEKHQVTGWVLISPLTKAEDGSYECHASNTQGEASAVGSIHVVESISDIPVQMVKDSEL a4jye7_danre vstm4b sc:d805 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MKISAVLTALLTNLLLGNVCSSINVTVSPAPFTVVAEGQNITLSCQVSQRKRSASLPVVRWMFQPESGGEELLVARVNMKRAKFYGNYTKSFRKPKMKLTVVKQGRIFNLLIVNISERDRGVYSCRVQEFNKHQERWKASTNSSASTQLRVHVLPAGRPKEDLWS a8bb40_danre lrrtm4l1 sc:d0341 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MGSLACDMRLAGLLLLQASSLLLFSSGERMCPYSCHCEGKIVHCESSAFQDIPENISVSCQGLSLRYNDLHTMLPYQFAHLNQLLWLYLDHNQIMFVDSRAFQGLRRLKELILSSNRISQLHNVTFHGVPNLRSLDLSYNKLQELQPGQFYGLRKLQNLHLRSNGLTAIPVRAFLECRSLEFLDLGYNRLRVLTRTAFLGLSRLMELHLEHNQFSRINFFLFPRLANLRALYLQWNRIRAVNQGLPWSWYTLQRLDISGNEIQVLDPVVFQCLPNLQVLNLESNKLANVSQEVVAAWISLTTISLAGNMWDCGPGICPLVVWLKNFRGTKDTNIICSSPKHLQGEKVIEASKNYIDCDDYESTAQSPLYLQTFDPNYDLALEPTEPTMAPTTPPPPLPSPASEAPFPPSQSRPPHRPTFPSRTNTDPRDSHQRTPSSFDSSLVTPVPEQDNVSFHK q8uvd6_danre boc protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MSGTLNWIPWERKRKIRVLCSLCVLLFCLQDSNAVTDDVPVFTEEPFSVVQKLGGSVTLRCSALPNHVNISWHLNGRELPAGGDEELGVLVRPGSLYIPSLTNLTVGRYQCVATTSVGSCASVPANVTAAKLRDFEPDDQQEIEVDEGNTAVIECHLPESQPKAQVRYSVKQEWLETSKGNYLIMPSGNLQIANATRDDEGPYICAAYNPVTQEIKTSTSTDRLRIRRSTSEAARIIYPPASRSIMVNKGQRLVLECVASGIPTPQVTWAKDGLDLRNHNNTRFLLSNLLIDAASESDSGTYVCLADNGIGSTSSAQVLYDVQVFEPPQVRVELQQQDVAWGDTVRFSCQVRGKPAPTVVWLHNAQPLSPSPRHRVSAQVLRVLNVGPQDDGMYQCMAENGVGSSQAATRLLTLPTVPSRKMPMIRPLSPDKVLREQPPLKPPVSTSAVLPFDCSEVRVSPAEAPVILSQPRTGKADYYELTWKPRHDGGAPVLEYIIKYRKAGESPGEWTTNTISGSQHKLILTKLQPASLYEVEMAARNCAGLGQPAMMTFRTGKWRRGGPIGPPKTPVVQPRLSPPEAPDRPTVSMATETSAYVTWIPRGNRGFPIQSFRVEHKKLRKGSGDWEVAVNNIPPSRLSVEVTGLEKGTSYKFRVLAVNVLGASPPSAPSKAYTVVGSGPPNRRPIDGPYITYNEAINETTIILKWTYTPLNNTPIYGFYIFYRPTDSDNDSDYKKDVVEGDRYWHSITDLQPETAYDIKMQCFNEGGESEFGNVVILETKARPHQRTTPPETASSRPEHPGNPVPRPGDLPYLIVGVVLGAFVFIIVAFIPICLWRVWAKQKQTLDMRFPTLAATVSPCQYTMVPLQGLALGRACPVDPHLSPSHTVYAPKAEYIPNGKHAAQRLPPGHQEDPNYELECDALLPQDLPNQQQNIHNYCNGVPGCPEEGFCVSDDSPLRLFSLSDAPLESQDDHSLNECIHTEEELTADLTLLSIAEASINRLLQQAEPQQEGTTENTKQLEEQGTHDPEDG a8bbg3_danre lrrtm1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MLMDFLLIGLYLKWPLRKPPGLILCSLGIVLKIVPLVGGSCPRLCRCDNKQLYCEGLNLTDIPQNLSSAIGLSLRENNISELREGNFVGLSQLTWLYLDHNNIEIVEESAFERLRRIKELDLSTNRIESLPNGTFRPLPNLRILDLSYNRLQSLEPDLFHGLRKLTNLHLRYNALKFIPVRIFQDCRSMQFLDLGYNQLQSLARNSFAGLFKLTELHLEHNELVKVNLAHFPRLISLRTLYMRNNKATIVVNTLEWTWDYLEKIDFSNNEIEYIEPHVFESVPKLNTLMLDSNKLTYIDQRILDSWTSLSSITLSGNDWECSRNVCALASWLSNFQGQRDSGLLCANPDIAQGEDILDAVYAFQLCEDNVEATTQTFTVTRNRPRGFIYEGPTKNPYDLQDMEGGEVVTNSLTVTASGDDLESTMKIHK q8ay67_danre neo1a neo1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MAERGARLLLSLFCLTITVSHAEKGSAVRNFSPFWFSTEPSDTLAVRGAPVLLNCSVHSESPAKIEWKKDGSFLSLASDERRHVLADGSLLISSVVHSKHNKPDEGVYQCVATIDNLGTIISRTARLNVAGIARFLSQPEMASVRVGDSQVLSCEVNPDLVSFIRWEQNKEAVELDHRVFSLPSGALVISNATETDAGLYRCVIDNAGPTKISEEAQLHILTETGEERTLEFLQEPQHVSKLVGESVLLPCVVTGYPTPEITWMYKDQLIEDSSGRFEILGGGSLRIFNLTEEDAGVYNCLAENTNGSIEAQAELTLKDSPQFLKKPVNVFAHEATDVIFECEVSGSPSPTIKWVKNGDAVIPSDYFKIIKEQNLQVLGLVKSDEGFYQCLAENDAGNVQSSAQLVILDQGSRGGAGPTPSAPRDVVASLVSTRFLKLTWRLPAEPHGDDVTYSVYYSLEGTNRERIVNTSRPGEMQVTIQNLMPDTKYAFRVVAHNKNGPGESSVPLKVETQPEVQVPGPAPNLHAVVMSPSTVSLSWDVPLIGNGEIQNYKIYYMEKGMDSEQDLDVNTLSYTMTGLKKFTEYSFRLVAYNKHGPGVSTEDISVRTYSDVPSSPPQNMTVEVLNSKSLMIRWQPPPADAQNGEITGYKIRYRKGTRKSEVAEITSGSQLYQLIDGLQRGTEYMLRVSAMTVNGTGPATDWTTAETFESDLDESRVPDVPSSLHVRSLVNSIVVSWTPPENQDIVVRGYSISYGIGSPHAQTIKVDYKQRYYTIENLNPNSHYVITLKAFNNVGEGIPVYESAITRPQSDPIDPDVDLYELFHAPYTPVPDPIPMLPPVGVQASVLNQDTIKVTWADNSLPKNQKITDARYYTVRWKTNIPANTKFKVANTTTLFHTVTGLKPNTLYEFSVMVTKGRRTSTWSMTAHGTTFESIPSSPPKDVTVVSKEGRPKTIIVNWQPPSEANGKITGYIIYYSTDVKAEVHDWVIEPVVGNRLTHQIQELTLDTTYYFKIQARNSKGMGPMSEAVQFRTPKAESSDKMANDQAPGISVKQGRPSAPDNGFGSPGKPDMSGTGDNHILVIVIIVSVGAFTIIVVVVGAFLCTRRTTTQQKKKRAACKSANGSHKYKGNSKDLKPPDLWIHHERLELKPIDKSPEPNPVMTDTPIPRTSQDITPVDGSMDPMLQRRNSYRGHESEDSMSTLAGRRGMRPKMMMPFDAQPPQPVISAHPIHSLDNHHHHYHLGSLASPTRSYLHHQSSTRSIATPISHLDRAESTESVRNTPNAELLPPSGQPSCTTDLSETDISFHSSAAEEEPAFATPTAHVRPTHPLKSFAVPAIPAHAMYDSAALPSTPLLSQTGPHSVKTASIGTLGRTRTPMPVIVPNAPDVSEGCRLHEDAGSNYETDELSEEMAHLEGLMKDLNAITTA a4jyi8_danre Fibroblast growth factor receptor fgfr2 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MGSVSRGRPRRRGGCGDTPTTDGMFARGWLLGALLLMTLATVSVARPSLKIDLVNTSAPEDAISSGDDEDDTERSDDVGADGEQMRLPYWTFPEKMEKKLHAVPAANTVKFRCAAAGNPKPKMRWLKNAKPFRQEDRMGGYKVRLQHWTLIMESVVPSDKGNYTCLVENQYGSINHTYTLDVVERSPHRPILQAGLPANVTVQVGQDAKFVCKVYSDAQPHIQWLQHYTKNGSRYGPDGLPYVRVLKTAGVNTTDKEIEVLYLPNVTFEDAGEYTCLAGNSIGISYHTAWLTVHPAETNPIETDYPPDYVEIAIYCIGVFLIACMVVIVVVCRMRTSAKKPDFSSQPAVHKLTKQIPLRRQVTVSSDSSSSMSSSTPLVRITTRRSSAHDDPIPEYDLPEDPRWEFSRDKLTLGKPLGEGCFGQVVMAEALGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGRHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDIARVSDEPLTFKDLVSCTYQVARGMEYLASQKCIHRDLAARNVLVTESNVMKIADFGLARDVHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMKDCWHAISSHRPTFKQLVEDLDRILTLATNEEYLDLCAPVEQYSPSFPDTRSSCSSGDDSVFSHDPLADEPCLPKYQHINGGIKT b3dgs1_danre fgfrl1b protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MFPERGSLAFLSVLIVALSCEARGPPSVSRPVENRQTAKLGCTVRIPCPVEGDPPPLVLWVKDGRNVNPGWSRYKVLKQSLKIKEVELEDAGVYICRVTNGFGSLALNFTLIVIDDAAVPQNPPPPDAAEPNADLSLQEPTREPWVKPRFSQPTKMRRRVLEQPVGSSVRLKCLASGNPTPVITWWKDQSLLDNPQQSKRPQWTLTLKNLQPQDSAKYTCHVSNAAGHINATYKVDVIERTNSKPILTGTHPVNTTVEFGGTASFQCKVHSDVKPVIQWLKRVDPGSEDRYNSTLEVGGQHYVVLPTGDVWSRPDGSYLNKLAIVKARDEDAGMYICLGANTMGYSVRSAYLTVLSDPKVEKDVIPRHISPGLPWPLIIGIPAAALLIVGTIVLWLCHSRRRQSALPPRPTTYRDHHISDKEPSSPNTNKPDLPSHRLATGPATLSGPPKIYTKVYTDMHTHTHTHAHMEGKVHQHFHYQC fgfr2_danre Fibroblast growth factor receptor 2 fgfr2 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MFARGWLLGALLLMTLATVSVARPSLKIDLVNTSAPEEPPTKNQNCVPVLFSVHPGELLKLKCPLSGADDVVWTKDSSSLRPDNRTLVARDWLQISDATPKDSGLYSCSATGLRDCDVFSFIVNVTDAISSGDDEDDTERSDDVGADGEQMRLPYWTFPEKMEKKLHAVPAANTVKFRCAAAGNPKPKMRWLKNAKPFRQEDRMGGYKVRLQHWTLIMESVVPSDKGNYTCLVENQYGSIDHTYTLDVVERSPHRPILQAGLPANVTVQVGQDAKFVCKVYSDAQPHIQWLQHYTKNGSCCGPDGLPYVRVLKTAGVNTTDKEIEVLYLPNVTFEDAGEYTCLAGNSIGISYHTAWLTVHPAETNPIETDYPPDYVEIAIYCIGVFLIACMVVIVVVCRMRTSAKKPDFSSQPAVHKLTKQIPLRRQVTVSSDSSSSMSSSTPLVRITTRRSSAHDDPIPEYDLPEDPRWEFSRDKLTLGKPLGEGCFGQVVMAEALGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGRHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDIARVSDEPLTFKDLVSCTYQVARGMEYLASQKCIHRDLAARNVLVTESNVMKIADFGLARDVHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMKDCWHAISSHRPTFKQLVEDLDRILTLATNEEYLDLCAPVEQYSPSFPDTRSSCPSGDDSVFSHDPLADEPCLPKYQHINGGIKT a4jyn2_danre bcan protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MFLHILLSAICLCVLSSSSVLSSATDDSSALKVAIPASSPVSAVLGGSLTLPCLVSLPRTPSLGRHAVLTQPRVKWSFLSSDRETEILVARGERVKVSEAYKGRASLLNYATSSADLTLRLEGLIHNDTGFYRCEVQHGLEDSHDQAQVKVKGVVFLYRHTSSRYAFTFDEARDACKDIGAEIASPEQLLAAYHSGYEQCDAGWLSDRSVRYPIQMPREGCFGDMDGLPGVRNYGTMENDELYDVYCYVENIHGEVFHGSTPQRFSLSEAKAYCEQQDAQLATTGQLYAAWNDGLNHCSPGWLADGSVRYPIVTPRERCGGSEPGVKTVYRFSNQTGFPEPNTRHDAYCFKANSNSQTAPPADYMATSPEETEQHIVTLAEPQEEYSVHQVTQRSENEAQGAVESFSIYSTQTASETEEHNHTSSPQEDIIIGSRKDLTTPTSTEGNTETIEVTWQNVGSIPEIYIDPKRNNFMLEGEPEIKASAVDGVKSSNHRHYQPMPDTNLEPGEPIDFIPPTVAHHGTTEEPSSPPKEINGSKHYQPMPDTNLDDEDHMTTQSTTLQYDSSNNTTQDASVQSTYHPDGATLETNAGNITEAPESDDNQGLFTHTTQPTSTSTSSREGWLESSGEDSTTEKAIYLDLTTKEAVNLDSTTEEPIHLDSTTEEAIHLDSTTEEAIHLDSTTEEAIHLDSTTEEAMFSTHNSEIYRASTAETLTESYSSTHLNNISPTDDVTDHFTLSTTLRETELSESSGDHDEVLPVILFTTPMPHLLDSLTTRAPVQLEISSPQQIEGVLSDSTTASALRVVEEEVEKVEQEELGEQPETKITTSTELNHSTVTLSIDGSDEEESSGEPSENWTSVTENPYSNTATITPSNLTDLQEHNETNSDDEDNQAITVEPTTDLEVTFLPHGTQTSIWQSVVTSPGELNADVEFSGEAALTTDDMRALEESESTNAPISEQTEETLKPSSTTDHNDADDDDNDNDDDELITKAITGNEEDENDVKTTHESFIIPVRPTQRVLIRTSYISDACLENPCKNGGTCVDSGGDQRCLCLPTYGGDFCETDLEHCEPGWEKFQGFCYKHFAKRQKWEVAEQHCRMCGGHLVSVMSPEEQLFINDKYREYQWTGLNDKTIEGDFRWSDGNPLLYQNWYRGQPDSYFLSGEDCVVMVWYDDGRWSDIPCNYQLSYTCKKGISAFCGQPPLVLHAKMFGRRQLKYRANSQVRYYCESGFIQRQNPIITCQSNGLWEEPKIMCSPAGPTYSNGDLVTWRTGQNKEIVIEDSTTKTPEYLDIKWNF a4jyl6_danre sid4 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MKLQTAALTLSALLCAVCAQAPSVSVRPRTAAVRLGETVSFQCRVTSGAQPVMLEWRKINNQPLGDNVKIGPDGAVLTIANVRLNNQGGYRCIATNAQGKSTVTANLSVKHPPKVRVSPAGPLTLRVGEIVTLDCSVSGKPRPSVSWIRRQAGGETELVSTTTDSTTSLQVTMATAENAGMYVCRAQNGEGLAEGEVELVMEGGAFPQASVSETELTAVEGQSVSMHCQASGSPAAVLSWSKLRAPLPWQHKVDGGTLTLSNVGRQDSGQYICNATSALGFSEAYVQLEVDSPPYATVLTEVVVLRVGDALRLQCLAHGSHPIRFRWMRVGGACMSTGAESTKDGLLRIPQLKSSDSGTYKCTATNHVGSSEALSRVTVKA a8bb30_danre lrrc24 si:ch211-215e19.1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MDPGQMSAVLVLMLAQLSSTSLACPSGCRCYSLTVECGSIGIKEIPQGITQGTQTIFLQDNAIGQIRQRDLSDLGQLHYLYLQNNSISTLEPGAFRSLGLLLELALNGNRIHLITADVFRGLDHLRILYLAGNQINRLEDYTFRGLQRLQELHLQENVLEVLGDQALVGLSSLALLDLSRNNLRTLSPASLKPLVSLQVLRVTDNPWRCDCALHWLRGWINEEGQRLLSSAERRMLCAEPPRLSHLSLVEVPPNSLVCIPPVVQLEPSHLTVRLGESLRVSCQASGYPQPQVTWRKASHGKAQLSPRGLVQEVGMDGDTRNGGRLVTARPGGKGGPSSHGPIRGGADDGADRENFDPDTGSGMLFLSNVTVAHAGRYECEAWNPGGVARVTFHLSVNMSSSSSRSEIWPRLHSSSYYHPSSVDVSQEPLYELESMDFNALGTAT q6nz26_danre igsf8 zgc:77222 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MAPRWIVIFVAVLCVLQVYVCREVTLPAGPLYRVAGFSLSLPCAVSAYEGPRTQDFEWYLYREDAGGRQIGVVSTRDTGFPYAPFQSRVQSGEVRVERDSGDKARLIIQRLRADDQGRYECYTPSTDTRFLGNYSSSVTVKVIPDTLQITHSRILSGQPVIEGTELQLTCAASVQSQQHTHVSVTFGVRSSRETESQGHNLREIISIDRELRVTPGHSGGFAKRHRDGEITLEKRKGDRGQDLYTLKISALTPEDSGSYFWEAAQWIRDPDGKWERIALRTMELGNLTVQPLADSLTVRSVPEGVVSLQPGAPLSLSCVVSGLGSWNRSALLVQWMRRGLAGGVEVELARVGPDGVVLWGDDASRAGGGSMEREADGKFSLRLFSVHPADAGLYRCAVSVYAGRKTPGPASPATVTQRSDWVTVSLKTEEVRVSAVIDLPRRPLLKRGSTVSIFCNVSVWSRTPAQVALEWRHTPEDPLQKDRSVSADSKGRVLAVLTRDGLTRIYSNGSDLSVERVSEICYRLRVFSADQPDQGLYQCEAQVWAQDPRGGWYDTGVRAESTTARLYLYARVTDLLLIPLVVGVSSALFVGVLIIATVTCCFMKRLARQRSRVRK q6p5m1_danre Platelet-derived growth factor receptor-like protein pdgfrl protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MKFWLFFTLALLWLEVQNGVCQQVKRKKEAGENRIKPGRKRAKVRYPKVKEKDTGSKGHSILTQVLDKGRFLRLGESLSLNPGKTLELRCKGTKIGWAYPSYLDTFNDNRLSIKQHERYGQLILTSPSAADTGEYSCWVLLCDGQECEKDVDTISATYIYFTDKDELFVPSAIHFEIIYLRPDKPATIPCRVTNPKIKVSLHREVPAEEIAVDGTQISYNPTKGFIIQNPSPEHKGAYYCKANSTSKTTPQISTKYQLLYVEVPSGPPFATIEASSNSVSGGDVFNVTCTVLGEPEMNVSFSWRYPGQDQRPVNIQDSWRLINRGVGHTTRISQSVMIVDDVETIDYGKYICTAKNKNGETLVATSVKSRD a4jyr2_danre nitr14b DKEY-149K8.5-001 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MILWAFVTVLCVARTAHSRIEQPEKVMIVELGNSVTLRCISCNNNIFWYKQVAGQQPRVISAFQKLSEPIFYNKYKNERFWGKRLSCSTNLTISDIIQSDEAVYYCASREFYTEFGNGTHLKIKGHQAAAYKNSNLDHLNSSIKCRQKFNENSTTEMCNYL q5w433_danre siglec-4 mag protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MKGLELLLLPLLLLLKDASAQWNVWMPRDISAMTNSCVVIPCSFTYPSGIRPYRGVHGIWYFGHPYPQLFPPVVLKSRTDIVHESYKGRTKLLGDLTQKNCTLLISNIGVEHSGKYYFRADLGGANIYTFPDFTKLQVLDQPNIDVPEEIVSDQSLDLTCYVPDNCPDMSPEIHWMYTDYLPDPVFTPDQVEEGNTAVLSSTLTFTPKPMHNGQLLGCRVNFPNTTYVYERLITLDIRYAPRTVWVNVSQEVMEGSSVVLHCDVDSNPAPMITWYFGDKELMSETASNSSLSLENLTPEQEGVYTCVGDNGYGNMNTSMYLAVNYPPREPWINESLTVLEGSSVSLQCTSKGNPMPTLTWLKDGELVGTITAEEGSVLELHEIMPQADGVYRCLAENDYGASSSLNITVEFAPVLLDDSKCTIVREGVQCVCIASGNPEPAIEFYLPDHVTINNSNNRFNYYTHSDGYTSTGVIKLQDKGERGNNGDTAVHVHCSITNIYGSETIRLELQQEKKYMMAVIVGTIGGVAVIAFIIAAVRYVGQNNKKENGNPGQDVGSKVENPSMFYSAVKKDKQSLRKKVLKTELLGSKFNSILEEGTGDDSDYQSVGPMAGMERQELNYAALEFLHGRHREGVFRRADGDGSDYTEIKAK b0v0e5_danre Amyloid-beta A4 protein appb protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MGMDRTVFLLLMLTTLSLAIEVPSDDSVGLLAEPQVAMFCGKLNMHINVQSGKWEPDPTGTKSCISTKEGILQYCQEVYPDLQITNVVEANQPVSIQNWCKMGRRQCRSHTHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDMCESHLHWHTVAKESCGDRSMNLHDYGMLLPCGIDRFRGVEFVCCPMEEQKDLDSEEQEEANSDVWWGGAETEYTDASVLKEQVTAKPDPAVTEDDEDLNNEEDQVWDNDEDGDGEDDEDEEDDDEDIIDEQDTSEQTSNIAMTTTTTTTTESIEEVVRAVCWAPARSGPCHAKLPRWYFVAEKGRCASFTFGGCGGNRNNFESEEYCMAVCSSSVLPTMAPSPADAVDRYLEAPGDINEHMRFQKAKESLEAKHREKMSEVMREWEEAERQAKNLPRADKKTIIQRFQEKVESLEKEAAGERQQLVETHMARVEALLNDRRRQALESYLSSLQSDQPRPRQVLNLLKKYIRAEQKDRQHTLKHFEHVREVDPKKASQIRPFVMTHLRVIEERMNQSLGYLYKVPQVANDIQDQVAVLVQRDQAEVTQQLSSLQSKMRVSYGNDALMPDLPDSTTPLDNLPPEQDGLGFIHPESFNQANTDNHVEPVDARPIPERGLPTRPEIPKVRLDIEERHNAGYDVRDKRLMFLAEDMGSNKGAIIGLMVGGVVIATVIVITLVMLRKKQYTSIHHGVIEVDAAVTPEERHLAKMQQNGYENPTYKFFEQMQN q7sx76_danre fgfrl1a protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MELLWIVFFIFDIIFITDCARGPPRVAEKIAHRQTVRIGRTMKLQCPVEGDPPPLIMWTKDGRNIHSGWMRFRVLQQALRIKEVEADDAGTFICKATNGFGSVNINYTLIVIDDSSAGREGARPAGETEYSTDLTGKLVRPRFTQPAKMRKRVIARPVGSSVRLKCTASGNPRPDIVWLKDSRPLTPEEVGEGRKKKWTLSLKNLTPEHSGKYTCHVSNRAGEINATYKVEVIQRTNSKPILTGTHPVNTTVDYGGTTSFQCKVRSDVKPVIQWLKRVEPGGEGKYNSTIEVGDHHFVVLPTGDVWSRPDGSYLNKLLITRAKEEDAGMYICLGANTMGYSFRSAFLTVLPDPKPPFSPIPSVLPPSLPWPVIIGIPAGIVFILGTVLLWFCQSRKHCSSGAIISAQTLPNGHRQPPRDRPADKDCIASVAYEEYLAQQQQQQLLLAQSAPKVYPKIYSDIHTHTHSHVDGKIHQHQHIHYQC a4jyq2_danre Fibroblast growth factor receptor fgfr3 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MVPLCLLLYLATLVFPPVYSAHLLSPEPTDWVSSEVEVFLEDYVAGVGDTVVLSCTPQDFLLPIVWQKDGDAVSSSNRTRVGQKALRIINVSYEDSGVYSCRHAHKSMLLSNYTVKVIDSLSSGDDEDYDEDEDEAGNGNAEAPYWTRSDRMEKKLLAVPAANTVKFRCPAAGNPTPSIHWLKNGKEFKGEQRMGGIKLRDQQWSLVMESAVPSDRGNYTCVVQNKYGSIKHTYQLDVLERSPHRPILQAGLPANQTVVVGSDVEFHCKVYSDAQPHIQWLKHIEVNGSQYGPNGAPYVNVLKTAGINTTDKELEILYLTNVSFEDAGQYTCLAGNSIGYNHHSAWLTVLPAVEMEREDDYADILIYVTSCVLFILTMVIIILCRMWINTQKTLPAPPVQKLSKFPLKRQVTVSLESNSSMNSNTPLVRIARLSSSDGPMLPNVSELELPSDPKWEFTRTKLTLGKPLGEGCFGQVVMAEAIGIDKEKPNKPLTVAVKMLKDDGTDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVLVEYASKGNLREYLRARRPPGMDYSFDTCKIPNETLTFKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSYGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHELYMIMRECWHAVPSQRPTFRQLVEDHDRVLSMTSTDEYLDLSVPFEQYSPTCPDSNSTCSSGDDSVFAHDPLPEEPCLPKHHHSNGVIRT b0cm22_danre kirrel3 kirrel3l protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MDLQHALSVMRLGENQVRGNGAPPEKGVSQAAYFSQQPQDQVVVAGQSVTLPCVIVGYRGMVQWTKDGLALGGERDLPGWVRYSLMGDPLSGEHSLVIDSAELGDDAIYECQATQAGLRSHRAKLTVLVPPSDPIVEGGPVVRLKAHTPHNLTCRASGAKPAAEITWYRDGEIMQNAIYSKSLMEDGKRETAVSMLPMVPEDSDSGRTYTCRVLNPAAPAGRQTSVTINVQHPPSVTLSVQPQTVMEGAKVLFICSASANPEITGYRWSKGGVPISEANGDSLEVTADHSYFTDPVSCEVSNSVGSTNVSTLVDVQFGPRLLTEPKPQIVDIGMDAAFTCSWTGNPPLTLAWTKQGSNVVLSNSNTLQLKAVTQDDTGTYTCKAIVPRIGVAERDVTLTVNGPPIITAEATQQAIKHSKGKLECLVGSSPPPDKIVWTFGDMMLSSGSSGRFSVQTVNSDQGVLSSLILSETLAQDFQLRYNCTAWNRFGTGTALVTLEEQEALPLLIIIGASVGGGCVFIVCVITLVSICCRHNAKGKKGTRLSKSDIRVQIVHSDHNAARGNDDEEDVKEPMAPNSSESPGTSRTEHSDLLEEEDDERSDIKDPTNGYYNVRAHEDRHITRTGFSEYANNARPVYTPTQLPSPSPLYGQHSTQPRIYDFSQRYATTPANRTTYEQQQPQQPQQQPQTPTAYPQETVYSGSTYLPATYGRAFTSYVKPASYEKVDGYEHSDQASKVSSSSRFSYASSQVSSQQSDYGRPSQQRMQTHV q2hpg2_danre lgi1a Lgi1a protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MMCLRRAAVLCVLLAALVLGGRRRSSRCPAPCTCSKDNALCANTGAIPRSFPQDVISLSFVKSGFTEIPKESFIHTPALHLLLFTANSFDSINEDAFLGLPHLEYLFIENNQIKSISPFAFRGLKSLIHLSLAYNNLETLPKDLFKGMEALTKVDLRGNLFSCDCKLKWLVDWMFHTNATVDQIFCNGPEGYQGKKINDLEAQTFDCITTDFTLLKSLEFQSISVEAFSFAGDQFVVFAQPFSGRCSFMEWDHVQMEFRNFDNITSTSTVICKPLVIDSQLFIIVAQLFGGSHIFKRDVSANKFIRIQDIDILKIRKPNDVEIFEVDGESFFIIADSSKAGSTTIYKWNGNGFYSYQSLHPWHRDTDVEYLDISGKPHLILSSSSQRPVVYQWSRGSAQFERRTDIPEMEDVFAVKHFTVKNELYICLTRFIGDSKVMRWDGSMFTEIQTVASRGSMVFQPFSVASWQYAILGSDYAFTRVYRWDAKKRQFVPFQELNIQAPRAFSLVFIDNREFLLGSSFKGQTRIYEHLVLDLSS b0clv1_danre esam esama ESAM sc:d0254 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MERRTSTKFHNYLSIFTFLCCFSSGELAQLVLPYENVDVIQGKMVVLQASYSSTDFQKNTVVWNYMQSATSTEMIISFVNGDFSHGTSQFAGRVGFFHNMPNTNLSLYINNTKVSDSGRYVCQVMIPGASGLTGTLNLNVKVPPSIPVCKVKEKPVLKANITLSCNSNEGKPAPKYKWIKTSPTSEVFFSPALNETAGTLKLNNLSSNMSGKYVCTSTNSAGEETCYINLEVITSTNAGMIAGVTFGCIVALILIVIFLIFMWTRRKDTEEDLANDIKEDAQAPKRVSWAKSGTGSDIISKNGTLSSIHTSSYPRDAHNHHHYPHSDTASIITATGSTAGYRSQPPVDATLERSLPGYNTNPAPTRGPFGPPSTNGGSQHTSMPRTAPAQPQIPRPPVLPTTVTAANISRMGGVPIMVPAQNQAGSLV q6dh50_danre zgc:92647 havcr1 kim1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MTDLHSWFLSSWILCCLTICRCSDIIVQSFEGDNVTLPCKYDSRYHGKCEICWMRGDIPSRGCGEEIIASDGDKVSTRNSDRYDLAGPIQHGDVSLTIFNIDKTDSGKYGCRVHVPGWFNDEKYYVHLIVDDDNKTRKEISSTISPSYAPRSSTAGMWLSNTTSVEPSVSVVYHESSSAESKDNVTVSAVLVPVLLLLLALIAIAAAFMWKQKKKTRASLEVRQNSEISVIYSNSGSSVGLYNREMAVENVYQIQAESEYEQWH a8bbh3_danre lrrc17 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MRLLCGLLLLCLVVWAAEARKGGRARRVRSRDHTTKRFAADCKETLVNGEKYFDCQERHLTAVLLGWPEDIHHLLLARNRIQVLRDNTFSHFRNLKSLDLQQNEISRIDDGAFDGLSKLTTLLLQHNRLQVASEGMLIPMPQLKYLRLHDNPWRCDCQLDSLVRFIQVPSNRNIGNYARCAEPREFSGRQLKKLDAEMLCSPEQEKEAILDPENQQLPAPQKKSDATSLCHTYMHPVPRMDCRNRDLKTVPADIPLDIVKLDLSRNTIKQLRQKEFVNVKELKLLNLSGNSLESIDTAAFTGLLYLGELDLSNNSLRYFQYGVLEDLYFLKRLSLGDNPWICDYNIHYLIYWLKHHPDVSHTGLVCSEPEEFRGWPVENYVKTYNAECPKDKQLGNLPDTDLAGNTPLELTAEIDEEEGPRPYRGHKKFETIRLN b0cm00_danre pdgfra protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MGFLKTHLVFGIVLLGVFSDVSKPWLVTDKEKEEFMLTPHSDFNITCFGMRRVTWVEPLPFNIKVHSGFNYSTLMITDAVASNTRFYTCQHEDHSETETDIYIFVQDPDVPFVSEHDAETDEIGTTIPCHVTNPHSEVMLRDLQSGDEVTVLYDPKLGFFGTIPPGQYVCETTVNGKTVRSIIYNVTNDMATDVPEVVDQNFSIQLSASMEDLKEGDSVNLTCETPAGMAFHQQWLHPQKQAKDGVPIKLTLQDKIQYILNIPKASVEDTGRYECSVTNQLTRQTRSKSLGITVHESSFVEIISNGIGPVEVVSLLEEKEFTIYIDADPEPKVTWFKDGQPLEDSYIFSKTTHLENLRYENILILRHPVEEDSGIYEIVASTGSRTSQFSFKLLIEVMFPVLPQSVQAPLIWPQRESMEVSLHSTFRLTCRGQAELSWNGPVFIDDQTNSVKKGLFISTVTISNATAVHTGEYVCSSEPFNSTESTIYIYVPDPQTPFVPSMTPFENHVLTSYDEMEIPCRVTDPSASVSLIHMETDQVMPSAYDSKRGFIGLFGAGTYVCRALIHGQNHDSIEYIVHGWIGGSDLRVELRAVKRTLLVGETITVDCVAKGSEMLEDHWKYPGKLANRGTKTVKENKLNLEIYYTLTVTNASPKDSGIYACSITDIMSNESQTKELTITVYDHEFVHINPLIGPVETARLDEVPEFKVDIESFPAPKVTWLKDSAVLGDDTAEISTNLLKIGETSYKGVLNLIRAKAEDSGNYTVKAEIGSISTSYSFYLQVKVPPVVVDLIDVHHGSAAGQEVVCTAGGSPFPEVDWYICKNLKHCANDSSQWMPLPINSTDITVELQMNVDNHIESHIIFHHLEGTVAVRCLARNDMGVVSREVKLMSSGPHSELTVAAAVLVLLVIVIIS q6pfk4_danre cadm2a igsf4d protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MMVKQHMLFTLYSICGIVLKDILAVSVAATKNKVRGAQGQVPLVQNMTVTEGGTANLTCRVEHNDNTSLQWSNPAQQTLFFGDKKALRDNRIELVRATSQELTISISEVSLSDEGLYTCSLFTMPVKTAKAFLTVLGVPKKPEINGLTKPVLEGDHITLTCVTSGSKPAADVRWFKNEMEVKGAKEVNASGKTFTVKSSLRLHVNRDDDGVAYTCRVDHVALTATHEETTQVLEVHYAPYVEIRQSTNVPQEGQYLKLQCVPKGNPSPDPVLWTKDGGELPDMDRMIVDGRDLTFTSLNKTDNGTYRCGATNHLGTSHAEFKLVIYDPNELKRATDHALIGGIVAVVVFATLCLIIVLGRYLARHKGTYLTNEAKGADDAPDADTAIINADGNHAHAEEKKEYFI q2ydq1_danre zgc:123297 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MKFICLLLLTACGIKDSRSEQYEVIRAAVAVFASVGDDVILPCSGKPNISVVDMRVEWRRSDLKDSLVHLYEDHEDRETEQNESYRGRTQLIHPELQRGNASLRLSSVKVSDEGRYKCIIGSESSKHEATVDLTVEALGWPPVITIDGFNPSGGLRLQCESEGWYPEPHLEWLNHEGVSLRPETTETHQKAGMFSIKHTIIVYHSDDKIHCRVKLKHHMLEAQIITSREVFKTWRTTAVLISVIVVFSGFAAMMFAVLLHKYRENRQLKIENKRLKQELDQLLQSQKTPEVTLDAGDSGKTCHTGPEDKEILVDNADP b0cm06_danre slit1b protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MPDTERSRPSSGLWIWALLLSLFLSGRSGACPPHCSCTGSTVDCHGLAFKSVPRNIPKTTERLDLNANNLTHIGKDDFAGLKHLRILHLMDNQIVSIDRGAFTDLKELDRLRLNRNRLQQLPELLFLKNPALSRLDLSENNIQMIPRRAFRGATDIKNLQLDKNHISCIEDGAFRAMRVLEVLTLNNNNISAIPISSFNHMPKLRTFRLHWNSLRCDCQLSWLSQWLRQRPALGLYTQCSSPAHLHGLNLAELQKKDFTCAGALDSSPQPCGLASGSCPPMCSCTNNIVDCRGKGLTAIPANMPESMTEIRLEQNGIKSVPPGAFSSYKRLRRIDLSNNQISEIAPDAFHGLRSLNSLVLYGNKITDLPRGVFDGLSALELLLLNANKIHCVRVNVFQDLENLSLLSLYDNKIQTLAKGTFAPLKSIQTLHLAQNPFVCDCGLKWLADFLRSNPIETSGARCSSPRRLANKRISQIKSKKFRCSAAKEQYYIPGSEDTRMNKDCNSKPVCPPKCRCEATVVDCSNLRLTKFPEHLPLSTTELRLNNNDLSILEATGLFRPLTHLKKINLSNNKITEIEDGAFEGASSVVELHLTANLLVSVRGGMFRGMDGLRMLMLRNNHIRCVHNSSFSGLQNVRLLSLYDNQLSTIMPGAFDSLPNLSTLNLLANPFSCDCRLSWLGEWLRSRQIVTGNPRCQNPAFLREIPLQDVAKPDFICDKDVLEQDVSCIPKPQCPEQCTCVDSVVRCSNKHLSALPRGVPLNVTELYLDGNVFVSIPQELSAFRQLQLLDLSNNKISSLTNTSFTNMSQLTTLILSYNALRCIPPLVFGGLSSLRLLSLHGNNISELHQQIFRDAASLSHLAIGANPLYCDCRLRWLSDWVKSGYKEPGIARCAGPQGMEGKLLLTTPGNTFQCTGPVDASVSGKCSPCSSNPCQNQGRCHNDPLHQYKCSCPQGYKGRNCELSISACEANPCVNGGTCRPEESRRGFRCVCPLGFEGLFCELDVDDCVDHQCVNGTICVDGVGNYSCVCAQPFSGQKCEEYEEDLCYPGQNPCQRGSTCIPTVSGPKCICPPGFVGDDCSVDYNECEGHYCQNGARCVDHVAGYTCVCPAGYSGRLCEASVSACDLLQCVNGAPCEEISGTAVCQCLPGFNGLRCEKLLSVNFIDRDSYLLLLRDATQSTHNNITLQVSTAEDNGILLYNGVNEHIAVELHDGHVKVTYDAGRQPGSTIYSSEIVNDGQFHTVELVTYERMVNLSIDGGLPTTLDSSGHIQPLTRDAPLYVGGMPENAKSLSSNHWPPVNGSSFQGCIRNLYINNELQDFTQTQMKPGVVPGCQACQELLCVNGLCQPDSAIGPVCHCQPGWGGKHCDQILLTAAAATNPCQKHKCVHGVCVAVDLQSYRCECVEGFHGQLCSQQDPCTALSCQHGLCQISPTGQPQCVCDSGYSGQLCDIVSPCQGEPVRDFHRVQRGDVQCRSTLPMSWTECRGGCRADSGLCCVGLRVRRRRYGFECDDGTTFTQEVEKTVECGCGKCV q98sw4_danre robo1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MTGRIIGFVLFIAVTHVCTGSRLRQEDYAPRIVEHPSDLIVSKGEPATLNCKAEGRPTPTVEWYKDGERVETDRDNPRSHRMLLPTGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAVSHNASLEVAILRDDFRQNPVDVMVAAGEPAVMECQPPRGHPEPTISWKKDGVNIDDRDERITIRGGKLMITNTRKTDAGKYVCVGTNMMGERESEIAELTVLERPSFLRKPSSQSVLVDQSVEFRCEAQGDPVPTIRWRKEDGELPKGRYEIWEDHTLKLKRLTSGDAGTYTCQAENMMGKTEASATLTVHVPPVFVVRPRNQVAGMGRTVTFQCEATGSPQPAIFWQKEGSQNLLFSSQPPPPSSRFSVSQTGDLTITAVERSDGGYYSCQALNIAGSVITKALLEVTDVISDRPPPIVRQGPTNQTVAVDGTVVLSCQATGTPIPTILWRKDGVLVSTHDSRLKQLDTGALQIRYAKLGDTGMYTCTASTPSGEASWKAYLEVQEFGAPVQPGRPTDPNLIPSAPSKPDVTDVSRTSVSLSWKPNLNAGATPTSYVIEAFSHAAGSSWQTLADHVKTESFVLKGLKPSAVYLFLVRAANAYGLSDPSPISDAVKTQDVPPTSQGVEHGQIQRELGDVVIHLHNPTILSSSSVRVQWTVEQQPQYIQGYKVMYRPSPEGAPQRVDWAMFEVGAPGEHSAVVTQLKKGITYEFKVRPFFNEFQGTDSDIKVGKTLEEAPSAAPRGVTVTGSGDNGTAVLVAWQPPPEEEQNGVVQEYKIWCLGNESRYHINRTVDGSTHSVLIPGLVAGVTYRLEVAAGTGAGPGVKSDPTSFQLDSSGRVLPPPLDDDNTISQQISDVVRQPAFIAGIGAACWIILMVFSIWLYRHRKKRNGLSSSYAGIRKVPSFTFTPTVAYQRGGEAVSSAGRPGLLNIGEPATQPWLADTWPNSCSNHNDCTINCCTGSNGNSDSNLATYSRPADCIANYSNQMDNKATNLLAPDTGLYSDVDLSNKINEMKTFNSPNLKDGRFMGPGGQPTPYATTQLIQSSLANNNMNSSSGGSGGGSADFNEKQSWKSSQGTPQKQADINTPLQYNVMEQNKLNKDHYRDEGPISVTIPYNQAQDVLTGETYSSSDRGSSTSGSQGQKKGGRTTKQAKQNPMNWTELLPPPPVNPPPCQEYTLVMDDSYDTDLQCPLPPSRMYLQPDELEEEEDEVELERGPTPPVRGAASSPAAVSYSHQSTATLTPSPQEEMHPMLQDNPDLHERRRLLVSPPPPPRPLSPAPMLQDNPDLHERRRLLVSPPPPPRPLSPPHTYGYISSPLGLDTDGLEEEDDDEEEGDETDAEVARVHQHHMMHPHQQHLPQQRALLRGAGTNPGLQHLWLESSVTGSMINGWGSASEEDNASSGRSSAVSSSDGSFFTDADFAQAAAAAAEYAGLRVAKHPGKGHHQLPVSGARKYQNLPAGHRPGSPVSTDSNVSAAPGQRRPLKRQKQHPAAQTGYQRREAYTEDLPPPPIPPPAMLKSPTHQAKTIPEGPRGAMSPRSSSADGKDRRTGAGGPRVRDGSDTRTSSSERRDGQDVQRGQRTGKNSKQDAAVKSRQHPGSEDILPYSRPSFPAVHSPRGERDPSSSSSLSSRGSGGRRRGEGPPGARRNPADIGLNTIGAFQTGGDELEMVGS b0clu9_danre vstm4a protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MKLSAVAIVLLTRVFIGELSDALNVTVTPGPVSMCMEGDNITLSCLVSQKKRSSSVLVLRWLYFPTPEDEHLVVRMGMKKAKYYGNYSKLFPQTKFLLWEENDGQLYRLLIKNVSREDGGNYTCKVQEIRKHRNKWRASSNGTGSMELRGIEESFPELYLK a4jyd8_danre Receptor protein-tyrosine kinase fgfr4 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MLSILKVFIAICFMELVCSRSITSGEPRAKDIRVSRHILTPGYPENATVLVGGHVKLVCKLHQPASTRLQWFKKDSNRLGPDGSPVLTALTPLLENLSKVNIFPLVNISLEDAGEYVCKAENSAGQATRSAWVEVLSEVSEEPTEEPSEHLLLELGDVLKLRCDTNRPGAVQWFKSGVRVQHNARIQIRAAVMEIADVTYEDSGVYVCMLRGTKEALRNFTITVADAVGSGDDDDEDNGLDDIGPETENDQVYISRAPYWTHTQRMEKKLYAVPAGNTVKFRCPATGSPLPTIRWLKNGREFRGEHRIGGIKLRHQHWSLVMESVVPSDRGNYSCVVENKYGSIAHTYLLDVLERSPHRPILQAGLPKNTTAIVGGDAQFLCKVYSDAQPHIQWLKHIEMNGSRYGPDGIPYVKIVKTGSLNMSEVEVLYLTNISMEDAGEYTCLAGNSIGFSHQSAWLTVLSEEDVAKEVDLMEAKYTDIIIYASGFLALVMAIVIVVLCRMQVHPSREPFDTLPVQKLS a4jyp8_danre cntn1a protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MIPEAFQPRAMKHTTTVLMLALSSRFWSVCADFPEVFGGESAGFGPVFEEQPLDTIYPEESPEEKITLTCRTRANPPASYRWRLNNAELVLAEGGDPHYSVSEGNLLISSPDKSKHAGNYTCVASNQYGSVTSRRARVQFGYLDMFSTDEREAVYVKEGQGAVLLCAPPPHFPEDLSFRWMLNEFPEFIPLDQRRFVSQSTGNLYISTVRSTDSGNYSCFVSSPAIAKSVFSKFIPLVPIAERSLRKYPADIKVKSPDSWALLGQNITLECFALGNPIPQIRWRKLDGVLPPLRHDVSMSGALLHLYSLQYEDEGLYECEADNSKGKDWHKTHLYVEGAPDWLEQISSSEVDIGGDYIMSCQASGKPKPHVHFLKNGHMYMKGHEVRFSRLGFEDSGMYQCVAENRHGVIHANAELRVFASAPSFQYNPVKPKLLGARNGRVVFECRPRAAPRPNITWSKGTELLHNSSRISIWLDGSLELLNISKSDEGKYTCFAENDRGRANSTGSLSITDATKITLAPSNADVSVGEDARMECVASHDPGLDLTFIWSLDGHTIDLQRDAQHYQRKMDSASGTSSSELLITHTQLRHAGRYSCTAQTPVDNTTASAELVVRGPPGPPGGVRVDEVTSDSVRVLWSHGTDNLSPISRYTVQLRESAAQQDWRDAATSPVNVEGNAEMATVVNLLPWTEYEFRVIATNTLGTGPPSEPSPKTTTREARPIVAPSDIGGGGGTSRELTITWTPVQSQYYYGSNFGYIIAFKPHNDPEWLRVTVTDPEVQKYVHKDPKIPPSTRFEVKMKAFNSQGEGPFSNSAFIYSAQDVPAEAPIITEARALSATEAIVIWVPVQLPTVERYQVRYWRESVENEASAQRVLVSSRENHTRLDNMKPDSHYLVEVRACNGAGYGPASQRNRIYTKKSPPSRPPKIISTKMHYSGSSINIAWEKVESLNNESTVAGYKVLYRQHGQPSGTLYTTEKQSIDLPMRRGEYLVEVRAHSEGGDGAVAQVRITGSAPAPALASALLLLPLLWTLML a4jyq0_danre cntfr protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MANIVTSFCCVVLAAVVVVYAQRRSQQGGRIQYEKISSDVTMQCGSLDNDASVTWKVNGTDVKARRREEGPRLILMEVNMSSNGLYSCFQNPDGQRRDQINLRVGFPPKEPQVTCRSNTYPRGFYCSWHLQHPTFIPTDFEVDVQHNQRPLEVTRDTVHKNRCHVKFPELFSSSPYYVNVTAVNSLGRASTTISFEESSIVKPDPPEKVVAKPVANNARRLEVTWNSPSTWPDVETFPLKYFLRYRPLIRDQWQHVELSDSTSHTITDAYAGKEYIIQLAAKDMEIGTWSDWSVAVHATPWMEEPKPITSTTESDVIPETTPGPPSAAPRVGEPTAACSTLLWSTHLLLACVLLSIM a1l1v2_danre Matrix remodeling-associated protein 8 si:ch211-15p9.5 mxra8a protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MMNLAVPLCARALFLIQLLTSFLFSPALGQSDGSGVVVAMYNISAPQGSQAVLQCHSQRMVWTQDRLKDRQRVVHWDLLRSGPDHAMERVVDMFSAGDQRIYNGYNQGRISMSKTAFKDGNFSMVIKDVVTSDKGIYSCNLHHHYCHLYESVKIQLNVTKSARKERRFWDGQKAVYVVLVGTTVVLPCFNRRPIWTEGNSQEDQQQVVHWDRQPPGVRHDRADRLIDLYASGERRHYGPLFVQQKMNISATAFTQGDFSLIISNIQLLDQGIYSCHLHHHYCGLHERRIFQLTVSPPVPQEPTDEPQFLPNEDPNTNLVEVPPHVINVILSEQRTHFLQQLGYILATLLLLALIMLAIVLLTRHRKKQGQDYDPRKVESPPLPTVTYVSPTSSVKKECERSYSDMRPSMQEETKLDYKNNLLKEAEMSKICSPKAIDLDREMEKASWK b0cm15_danre Amyloid-beta A4 protein appa protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MRSRELFILLMAVASTLAVEVPSDSGTGLLAEPQIAMFCGKLNMHINIQSGKWEPDPSGSKSCIGNKEGILQYCQEVYPELQITNVVEANQPVSIWDWCKKSRKQCRSHMHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDMCESHLHWHTVAKESCGDRSMNLHDYGMLLPCGIDRFRGVEFVCCPADAGKESESAAVEEDDSDVWWGGAEADYTENSMTRDAAAEPAVLEDDEDADEEEDEDQDGDGDRDEKIEEEEEEEERTQSTSAALTSTTTTTTESVEEVVRVPTPSSSPPDAVDRYLETPADENEHAHFLQAKESLETKHRERMSQVMREWEEAERQAKSLPRNDKKAVIQHFQEKVEALEQESASERQQLVETHMARVEALLNDRRRLALESYLSALQADPPRPRHVFSLLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRPQVLTHLRVIEERMNQSLGLLYKVPGVADDIQDQVELLQREQQEMSAQLANLQSDARVSYGNDALMPDSTAGLELLPAEDTQGFGFIHPESFNQPNTHNQVEPVDARPVPDLDLATRPVSGLKPDDIPELRMEAEERHSEVYTRSWF a8bb59_danre tsku protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MLAWKSKSSPADESRHMLTMASLLCLFFSLLGLAAIGAVKNCHPQCRCEVETFGLFDSFSLTKVDCSRIGPGNTPVPIPLDTSHLDLSLNSITSISDTMLSGPGYTTLVSLDLSSNLIAQISPKAFSKLRYLETLDLSSNALEGLSDGCFTGLPLVELDLSENQFKEFNLDLFTTRTQDLPIMVDLSRNLLTSIFRRTPGHPLYIKSLMLAGNQLKTVPKLNGIPLQYLNLDGNLISSIDTGAFDSLTELVHLSLSGLSELTLIHPGAFRSLKNLQALDLSNNSQLKTLNPDVFSGLVSLQELNLSNTAVTPLSRTVFMQMPNIKSITLGPNVHCWKTHKQGQFHRQIGQAKPNDILTCDNAGLIL q7sye5_danre chad protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MYTFHVLLVLVCLQFCAHTAFAAPTQCPSQCHCHGDLQHVICDNVGLKKIPRISEATRLLNLQRNNLGNLPTGGFSEMKGLISLHLQHCQIRELSGQAFKGLNKLIYLYLSDNEISTIKPGAFEDLTELTYLYLDGNQITSLPKGIFSPMINLFILQLNNNKLRELQPGTFKGAKDLRWLYMSGNELSSIQPGSLDEVENLAILTLDQNNLSTYPLLAMSKLRVVEELNLSKNPLSLIPDHAFRSFGRYMEKLHLNDMSLEKFSNAAFEGVTALKSLHLENNKLRSLPNSLEFSTIQNITLFNNPWSCTCPLTNLRKWMDTTRNRPDAVCASPANQKGKQIRDSTAFTRCKGKTKRARKGTRL lig1b_danre Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1-B lingo1b si:ch211-116a8.1 zgc:92338 lingo1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MTFLQVTIKMVAREASGHSYLVACWQPILILMLGTVLSGSATGCPSRCECSAQERSVVCHRRKLITLPEGIPIDTRLLDLSKNRLKAINPEEFLNYPQLEDLQLNENIISVIEPGAFSNLLGLRTLGLRNNNLKLIQLGVFTGLSNLTRLDISENKIVILLDYMFQELYNLKELEVGDNDLVFISHRAFHGLSSLEQLTMERCNLTSVPTEAFSHLHNLLTLKLRHLNVNVIRDFSFRRLYRLKILEIANWPLLESLTAKSLHGLNITTLSITNCNLTAVPYVAIQHLVYLRFFNLSFNPIEVVEGNKMHNLLRLQAFHLVGGRLVSIEPYSFKGLNYLRVLNVSSNSLSTLEESAFHSVGNLETLALHDNPLACDCRLLWVFRRRWRLNFNRQQPSCETPEFLQGKEFKDFPDVLPPNYFTCQKSKIRDHKAIHRFVDEGTTVQFPCQADGDPTPMIMWQSPKKQFITTKSIGRLSVSLDGTLEVRYAQIQDNGTYTCFAVNAGGNDTRLAHLHVHSYSPNWPHQPNKTFAFILNQPSDNSANGTGAMDPFPFDMKTLIIATTMGFISFLGVVLFCLVLLFLWSRGKGNAKPNIEIEYVPRKVDGENSPNEGSHKISMKMI a2cf10_danre hapln2 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MNFIALLLTSTCFFSCINAKYHYNQDKDKELKYLLEPLVFAEVSARRGHAAILPCVMRFKPSHYRVKWTKLEPSSRGVENIVLITNGHADKQYGSVGPRAALQRAHDLDVSLRLSDLELEDDGSYRCELINGIEDESVIITLRIEGVVFPYQSQKGRYRFTFFDAKEACAEQDATLATYKQLYRAWTEGLDWCNAGWLIDGTVSYPVLHPRPACGGDLLSGIRSYGPRHKTRENYDAFCFTSTTKGSVFFIEGQLNFAEAERACRRDGAGLAKTGQIYSSWRFQQLDRCDGGWLEDGSVRFPIINPREHCGGIAEPGVRSFGFPSKSMRLYGAYCYR q90z70_danre robo2 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MGPLTHLLLCGLVYFNQVDGSRLRQEDSPPRIVEHPSDLIVSKGEPATLNCKAEGRPTPTVEWYKDGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGAYVCVARNYLGEAVSRNASLEVALLRDDFRQNPTDVVVAAGEPAILECVPPRGHPEPTIYWKKDKVRIDEKDDRIKIRGGKLMISNTRKSDAGMYICVGTNMVGERDSETAQVTVFERPTFLRRPTNQVVLEEEAVEFRCQVQGDPQPSIRWKKDDVEIPRGRYDMKFDKDDFTLRIKKATASDEGTFTCVAENRVGKMEASATLTVRARPVAAPQFVIRPRDQIVAQGRTASFPCETKGNPQPAVFWQKEGSQNLLFPNQPQQPNSRFSVSPSGDLTITAVQRADAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPIIRQGPANQTLGVDSVALLRCHASGEPVPTISWLKDGVSLLGKDPRMSLQDLGSLQIKGLRLSDSGIYTCVAASSSGETSWSAFLEVKEAGSLVVVKDRDENELPGPPSKPQVTDVTKNSVSLSWQPGLPGASAISTYVIEAFSQSVSNSWQTVADHVKTTQYTIKGLRPNTIYLFMVRAVNVQGLSDPSPMSEPVRTQDISPPAQGGDHRHVQKELGEVIVRLHNPVVLSPTTIQVTWTVDRQSQFIQGYRVLYRQMSGLSSPGAWQTQDVKVPSERSMVLSALKKGIVYEIKVRPYFNEFQGMDSESRTARTTEEAPSAPPQQVTVLTVGNQNSTSISISWDPPPAEHQNGIIQEYKIWCLGNETRFHVNKTVDAAIRSVVVGGLQAGVQYRVEVAASTSAGVGVKSEPQTIIIGKDFRDVMISRNNSITEQITDVVKQPAFIAGIGGACWVILMGFSIWLYWRRKKRKGLSNYAVQSFTFTPAVTFQRVDGGLMSNGSRPGLLNASDSGYPWLADSWPPSLPVNSGSGGPNDLSFGRGDVMPSAQADKTGTMLSDGAIYSSIDFTTKGGFGSPSPASQATPYATTQILHSNSIHELAVDLPEAQWKTSLQAKQEMASLGYSLPDKNSCNNTLLFIPDYRLADGLSNRMPHNQSQDFSTTSSHNSSDRSNSLSGGKGGKKKKTKANVKPTKMNGSNWANVPLPPPPIHPLPGTEMDHYASEHHDGGGYDSDGWGPPLPVQTYLHQGLEDELEEEEERVPTPPIRGVASSPAAVSFGKQSTATLSPSPREEMQPMLQAHLDELTRAYQLDMAKQTWHMQGGPYPPQAPAPPVGYISSTLVSDIETDLPDEDDDDEEDEGYEMSPPIRGTEHTPGSSMDNLDSSVTDKGLPHRPRPASPFSTDGSTVGTHSLGHQRAARPTRKHKGPGTVPNRRDASADDLPPPPEPPPCQTARIPGSRNVPHPCDRKASSLERQPMMGLEEMRSSLDRQARTSLDRHQQVQDRLGSIERGDESRRGQKNGPFSEEALLPYNKPSFPSPGGHSSSGTASSKGSTGPRKGEGTRGQHQRSTTEQGESSYMGTNAQFSGEL q9de37_danre slit3 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MRWVKYWGTVAVLCGLLSCAVNGCPHKCSCSGSHVDCQGQAFKTVPRGIPRNAERLDLDRNNITRITKVDFSGLKNLRVLHLENNQISVIERGAFEGLKQLERIRLNRNRLQVLPELLFQSTTKLSRLDLSENQIQAVPRKAFRGITTVKNLQLDSNHISCIEDGAFRALRDLEILTLNNNNITLIPLSSFNHMPKLRTLRLHSNNLHCDCHLSWLSDWLRQRRGLAPFTQCMAPAHMRGLNVPDVQKREFVCTGPVETEPRSCAPQATICPAACTCNNNIVDCRRKGLTEIPANLPEGIVEIRLEQNMIKNIPAGAFSTYKKLKRIDLSKNQISEIAEDAFSGLRSLTSLVLYGNKIAEIPKGLFDGLVSLQLLLLNANKINCLRVNTFKDLQNLNLLSLYDNKLQTISKGLFAPLRAIKTLHLAQNPFMCDCHLKWLADYLFDNPIETSGARCSHPRRLANKRISQVKGKKFRCTGAEDYRSRLSGECFQDLVCPERCRCEGTVVDCSNLKLTKIPPHLPEHTTDLRLNDNEISILEATGAFKKLPNLRKINLSNNKLRDIREGAFDGAGGVLELLLTGNKLQSVSGRMFKGLIGLKTLMLRSNQISCVDNATFTGLSSVRLLSLHDNRISTIAPGAFNTLHSLSTINLLSNPYVCDCHLAWLGLWLKKTRVVSGNPRCQKPAFLKEIPIQDVAMPEFSCDGAEENVCLPSAPRCPESCTCSETVVRCSNRGLRSLPKAIPKDTTELYLEGNLLTSVPKELPNLKQLTLLDLSNNSISHLAPLTFSNMTQLATLILSYNQIRCVPVHAFDGLRSLRLLTLHGNDLSTVPEGAFNHLTSLSHLALGANPLYCDCELRWLSQWVKAGFKEPGIARCTGPPDMADRLLLTTPLNRFQCKGPADLNLMSKCAPCLATPCQNNGTCVSDVTGSYHCTCPFGYKGRNCEIPINACISLPCTNGGTCHLTPGLDGQYSCVCPPGYEGQQCELNPDDCEDNDCENNSTCVDGINNYTCVCPPNYKGDLCEEVVDPCLPGFDLCQHDSKCVPLSKGYRCECLPGYVGQQCEQDYNDCLENKCQHGAECVDAINGYTCVCKEGFSGLFCENHPPMVLLQNTSPCDQSDCQNGSECLVMEGEPVCRCLPGYFGTKCQKMVTLHFLGKEAYVELSGTRIRPPMHISFQVATDKDNGILLYKEDHDPLALELYQGHIRLIYDISKYPPTTVYSVESVNDGLFHTVEVLIQNQTLSLVVDKGTPKSLGKLPRPPAVDHNTQLYIGGVPSLIGTSGLRPGPFQSFNGCLHDVRLNGELQDLGAGLAGIEGVLFGCHSCSVCDQGACRQRGDEGVTCDCPTGHSGPLCEQMSSQDPCESSRCVHGECVAKGSSYSCLCVDGYSGQFCDRQDESSACKGLHCVYGECRLTESGEPACHCQPGYSGPTCETALTCEGEAVRDYLYRQMAHKICTSTSRVQRLECRHSCSSGLCCAPTKSRRRKLSFKCPDGSSFSEEMEITVECGCTKCSS fgr1a_danre Fibroblast growth factor receptor 1-A si:ch211-198o12.1 fgfr1 fgfr1a Basic fibroblast growth factor receptor 1-A protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MKMMMIMKTTLLLISVLLTQALQSQGRPAIQDEAPAEPTSYTLDSGEKLELSCKAKEDTQKVTWTKDLVPLVDGEHTRLRNDQMEIEKVEPTDSGLYACFAQGLNSNHTEYFNISVTDEEDEVDSSSEEAKLSNDQNLPMAPVWAQPDKMEKKLHAVPASKTVKFRCQANGNPTPTLKWLKNGKEFKRDQRIGGFKVREHMWTIIMESVVPSDRGNYTCLVENRHGSINHTYQLDVVERSPHRPILQAGLPANRTAVVGSDVEFECKVFSDPQPHIQWLKHIEVNGSRYGPDGLPYVRALKTAGVNTTDKEMEVLQIRNVSLEDAGEYTCLAGNSIGHSHHSAWLTVYKAVPPTQLPNQTYLEVLIYCVGFFLICVMVGTAVLAKMHSSAKKSDFNSQLAVHKLAKSIPLRRQVTVSVDSSSSMHSGGMLVRPSRLSSSGSPMLSGVSEYELPQDPRWEVQRDRLVLGKPLGEGCFGQVMMAEAMGMDKEKPNRITKVAVKMLKSDATEKDLSDLISEMEMMKIIGKHKNIINLLGACTQDGPLYVIVEFAAKGNLREYLRVRRPPGMEYCYNPDQVPVENMSIKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDRPSTCTHELYMMMRDCWHAVPSQRPTFKQLVEDLDRTLSMTSNQEYLDLSVSLDQFSPNFPDTRSSTCSSGEDSVFSHDAGADEPCLPKFPPHPNRGVAFKKR a8bbf9_danre flrt3 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MASNYMSFFVFFIRAGLLLGLANPLMTSASCPSQCRCDGTFIYCNDRDLTSIPSGIPEDATVLFLQNNRIKSAGIPTDLRRLNGVEKIYLYCNNLDEFPTNLPLNVKELHLQENNIRTITHASLAQIPFIEELHLDDNSVSAVSIEEGAFRDSNHLRLLFLSRNHLSTIPSGLPMTIEELRFDDNRISSISEASLQDLINLKRLVLDGNLLNNRGIGEMALVNLVNLTELSLVRNSLTSPPANLPGSSLEKLNLQDNHINHVPPGAFAFLRQLYRLDLSGNNLSSLPMGVFEDLDNLTQLLLRNNPWHCNCRMKWVRDWLRTLPSKVNVRGFMCQGPDKVKGMAIKDLSTELFGCSDTEIPTTYETSTVSNTLPPSRPQWPSYVTKRPVVKGPDLGRNYRSTTPSSRKIITISVKSSSAETVHISWRVSQPMTALRLSWLKLGHSPAFGSITETIVQGERTEYLLTALEPESSYRICMVPMETSNIYLSDETPVCIETETGSLKAYNPTTTLNREQEKEPYKNSNLP q5ri45_danre Decorin dcn protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MKSACLSLLLVSVCWALPFRQSGFMDFVMEDEPASGDGPGPELPTTRKPHVERLPMMPEGPEVPFCPFRCQCHLRVAQCSDLGLKTVPEKIPLDTTLLDLQNNKITEIKENDFKGLKGLQTLILVNNKITIIHAKAFSSLINLERLYLSKNLLKEVPANIPKSLQELRIHENQINKIKKSSFAGMANVIVMELGSNPLSSSGVDNGAFADLKRVSYIRIADTNLTSIPKGLPSSLFELHLDGNKITKVTADSLKGLKNLSKLGLSHNEISVVENGSLANVPHLRELHLENNALTAVPAGLADHKYIQVIYLHSNKIAAVGTEDFCPPGYNTKKAMYSGISLFSNPVPYWEVQPITFRCVFDRSAIQLGNYRKK a8bbg8_danre elfn2a ch1073-44m10.2 elfn2 sc:d0398 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MACGISLPCAVPTSFLILSLPIFLLFHAPSFVRGDCWLIEGDKGYVWLAICSQNQPPYETIPQHINNTVHDLRLNENKLKAIFFSSLSRFTNLTDLNLTKNEISYIEDGAFAGQANLQVLQLGYNKLTNLTEGMLRGLGRMQCLYLQHNLIEVIATNAFWECPSLSSLDLSSNKLAKLDASTFTVLGGRLIVCELAGNPFHCGCDLYTFLIWLEAFDNVTHTYDRLLCETPKELFGYPLVSPRGNHGRNARSILSSMCKDGVIVGGITALPPDLDSSGMEIDFYDQMGPHMQPTASSTTDPTYSPNIKLQTVSFSTASLLVQIPKPYSKMYILVQYNHTYVSDVINLKNKKQTVTLNDLKPHTNYTFCVASIRNSQRYNHTCLNFATRAPGPDDLRAGRSTTT a8bav6_danre lrrtm2 sc:d0320 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MGFHSRWPLVGQAPAALCVISMLLCLPPVSCTTCPQKCRCEDLQFYCDTQGLLAPPDGVDKGALGLSLRHNSISELSSDQFFGFTQLTWLHLDHNQITTVHEDAFQGLYKLKDLNLSSNRITKLPNTTFIHLINLQILDLSFNQMTALEPELFHGLRKLQILHLRSNSLRTTPVRAFWDCRSLEYLGLSNNRLRSLARNGFAGLIKLRELHLEHNHLTKINLAHFPRLVALQFLYLQWNKINNLTSTMEWKWTTLEKLDLTGNEIRVLIPEVFETLPSLKILLLDNNKLSNLDSQTMDMWKSLNVIGLSSNLWECTKRICNLATWLSTFKGRWEHSILCYSPEYAQGEEILDAVYGFQLCQNFSAPVVLTSTSTEAMLPDITSSLFGNMQTPTQDFYAEDFGSFTIVTTTTTTTQPPRTALATTMTVEGADVTEDYSAMDNTLLTQR a8bbb4_danre lrrc4.1 si:ch211-235l7.2 lrrc4a protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MCHIMSLLGRVAVRRARKAALLCVLFLMVQACVEVVAAAGPQGCPTDCSCNNQLSKVVCTRRGLTRVPPGIPSTTRHLNLMENAIESVQVDSFRNLHHLEVLQLGRNAIRQIEVGAFSGLTNLNTLELFDNRLTVVPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELRKLEYISDGAFEGLVNLKYLNLGMCNIRGEMPNFTPLVGLEELEISENLFPEIKPGSFRGLSSLKKLWIMNSQIGLIERNAFDDLASLVELNLAHNNLSSLPHDLYTPLKYLVELHLHHNPWNCACDSLWLARWLREYIPTNSTCCGRCHSPAHMRGRQLVELDRGDTGAMQCSAPFIADAPRDLNISAERVAELKCRTAAMSAVRWLLPNGTILTHASSHPRLTVLNDGTLNFSNVLAGDTGMYTCMVSNAAGNSNASAYLNVSAAELNTSNLSYFTTVTVEVLSPTSEMPKPKTTTTTAGASTTTTASPSVFQPVFISTPTVLLQSTDTPPSRPSVIPGSKVTTGKPPNPASTSLDEVMKTT cadm3-cadm3 798685 n/a 798686 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798686 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. A high A sc:d0647-sc:d0647 798685 n/a 798687 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798687 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. A high A nadl1_2-nadl1_2 798685 n/a 798688 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798689 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. A high A cadm3-cadm4 798685 n/a 798686 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798690 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. C high C si:dkey_225e1-a1l2d6 798685 n/a 798691 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798692 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. C high C kdrl-robo3 798685 n/a 798693 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798694 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. C high C slit2-robo3 798685 n/a 798695 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798694 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. D high D bgn-sc:d0340 798685 n/a 798696 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798697 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. D high D q642g9-a4jyf7 798685 n/a 798698 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798699 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E q642g9-negr1 798685 n/a 798700 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798699 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E si:dkey_225e1-a4jyi1 798685 n/a 798701 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798702 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E q6nzv3-ncam3 798685 n/a 798703 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798704 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E optc-ntn1b 798685 n/a 798705 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798706 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E optc-kdrl 798685 n/a 798705 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798693 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E kdrl-epyc 798685 n/a 798707 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798693 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E kdrl-robo3-1 798685 n/a 798693 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798694 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E kdrl-q6nw92 798685 n/a 798693 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798708 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E kdrl-sc:d805 798685 n/a 798693 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798709 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E kdrl-sc:d0341 798685 n/a 798710 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798693 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E kdrl-boc 798685 n/a 798693 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798711 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E kdrl-lrrtm1 798685 n/a 798693 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798712 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E ntn1b-neo1 798685 n/a 798706 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798713 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E fgfr2-sc:d805 798685 n/a 798709 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798714 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E fgfr2-boc 798685 n/a 798711 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798714 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E fgfr2-fgfrl1b 798685 n/a 798714 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798715 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E fgfr2-fgfrl1b-1 798685 n/a 798716 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798715 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E fgfr2-sc:d805-1 798685 n/a 798709 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798716 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E bcan-sc:d805 798685 n/a 798709 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798717 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E bcan-boc 798685 n/a 798711 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798717 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E lrrtm1-q6nw92 798685 n/a 798708 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798712 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E lrrtm1-sid4 798685 n/a 798718 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798712 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E sc:d0341-sid4 798685 n/a 798710 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798718 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E si:ch211_215e-q6nw92 798685 n/a 798719 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798708 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E sc:d0340-sid4 798685 n/a 798696 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798718 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E slit2-optc 798685 n/a 798705 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798695 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. F high F kdrl-q6nz26 798685 n/a 798720 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798693 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. F high F kdrl-pdgfrl 798685 n/a 798693 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798721 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. F high F nitr14b-epyc 798685 n/a 798707 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798722 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. F high F nitr14b-mag 798685 n/a 798723 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798722 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. F high F fgfr2-sc:d0341 798685 n/a 798710 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798716 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. F high F appb-fgfrl1a 798685 n/a 798724 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798725 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. F high F fgfr3-fgfrl1a 798685 n/a 798725 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798726 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. F high F bgn-pdgfrl 798685 n/a 798697 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798721 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. F high F cadm4-cadm3 798685 n/a 798690 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798686 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. C high C a1l2d6-si:dkey_225e1 798685 n/a 798692 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798691 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. C high C robo3-kdrl 798685 n/a 798694 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798693 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. C high C robo3-slit2 798685 n/a 798694 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798695 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. D high D sc:d0340-bgn 798685 n/a 798696 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798697 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. D high D a4jyf7-q642g9 798685 n/a 798698 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798699 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E negr1-q642g9 798685 n/a 798699 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798700 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E a4jyi1-si:dkey_225e1 798685 n/a 798701 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798702 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E ncam3-q6nzv3 798685 n/a 798704 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798703 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E ntn1b-optc 798685 n/a 798705 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798706 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E kdrl-optc 798685 n/a 798693 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798705 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E epyc-kdrl 798685 n/a 798707 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798693 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E robo3-kdrl-1 798685 n/a 798694 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798693 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E q6nw92-kdrl 798685 n/a 798693 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798708 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E sc:d805-kdrl 798685 n/a 798709 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798693 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E sc:d0341-kdrl 798685 n/a 798710 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798693 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E boc-kdrl 798685 n/a 798711 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798693 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E lrrtm1-kdrl 798685 n/a 798693 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798712 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E neo1-ntn1b 798685 n/a 798706 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798713 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E sc:d805-fgfr2 798685 n/a 798709 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798714 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E boc-fgfr2 798685 n/a 798711 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798714 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E fgfrl1b-fgfr2 798685 n/a 798715 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798714 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E fgfrl1b-fgfr2-1 798685 n/a 798715 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798716 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E sc:d805-fgfr2-1 798685 n/a 798716 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798709 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E sc:d805-bcan 798685 n/a 798709 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798717 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E boc-bcan 798685 n/a 798717 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798711 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E q6nw92-lrrtm1 798685 n/a 798712 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798708 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E sid4-lrrtm1 798685 n/a 798718 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798712 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E sid4-sc:d0341 798685 n/a 798710 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798718 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E q6nw92-si:ch211_215e 798685 n/a 798708 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798719 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E sid4-sc:d0340 798685 n/a 798718 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798696 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E high E optc-slit2 798685 n/a 798705 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798695 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. F high F q6nz26-kdrl 798685 n/a 798693 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798720 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. F high F pdgfrl-kdrl 798685 n/a 798693 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798721 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. F high F epyc-nitr14b 798685 n/a 798707 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798722 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. F high F mag-nitr14b 798685 n/a 798722 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798723 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. F high F sc:d0341-fgfr2 798685 n/a 798716 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798710 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. F high F fgfrl1a-appb 798685 n/a 798724 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798725 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. F high F fgfrl1a-fgfr3 798685 n/a 798725 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798726 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. F high F pdgfrl-bgn 798685 n/a 798721 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798697 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. F high F bcan-bcan 798685 n/a 798717 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798717 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. B low B kirrel3-kirrel3 798685 n/a 798727 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798727 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. B low B lgi1a-lgi1a 798685 n/a 798728 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798728 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. B low B sc:d0254-sc:d0254 798685 n/a 798729 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798729 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. B low B kim1-kim1 798685 n/a 798730 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798730 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. B low B lrrc17-lrrc17 798685 n/a 798731 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798731 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. B low B cadm3-pdgfra 798685 n/a 798732 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798686 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. G low G cadm3-cadm2a 798685 n/a 798686 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798733 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. G low G cadm4-pdgfra 798685 n/a 798690 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798732 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. G low G cadm4-cadm2a 798685 n/a 798733 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798690 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. G low G si:dkey_225e1-q2ydq1 798685 n/a 798734 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798691 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. G low G robo1-slit1b 798685 n/a 798735 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798736 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. G low G optc-b0clu9 798685 n/a 798705 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798737 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. G low G ntn1b-fgfr4 798685 n/a 798706 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798738 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. G low G cntn1a-nadl1_2 798685 n/a 798739 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798689 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. G low G appb-fgfrl1b 798685 n/a 798715 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798724 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. G low G appb-cntfr 798685 n/a 798724 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798740 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. G low G appb-robo3 798685 n/a 798694 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798724 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. G low G fgfr3-si:ch211_15p9_ 798685 n/a 798726 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798741 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. G low G si:ch211_15p9_5-appa 798685 n/a 798742 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798741 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. G low G robo3-slit1b 798685 n/a 798694 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798735 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. G low G robo3-appa 798685 n/a 798742 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798694 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. G low G a8bb59-mag 798685 n/a 798743 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798723 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. G low G bgn-mag 798685 n/a 798723 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798697 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. G low G chad-sc:d0341 798685 n/a 798744 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798710 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. G low G chad-sc:d0340 798685 n/a 798696 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798744 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. G low G lrrtm1-epyc 798685 n/a 798707 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798712 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. H low H kdrl-fgfr2 798685 n/a 798714 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798693 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. H low H kdrl-bcan 798685 n/a 798693 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798717 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. H low H kdrl-fgfr3 798685 n/a 798693 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798726 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. H low H lingo1-q6nw92 798685 n/a 798745 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798708 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. H low H lrrtm1-hapln2 798685 n/a 798746 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798712 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. H low H lrrtm1-bgn 798685 n/a 798697 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798712 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. H low H slit2-robo2 798685 n/a 798695 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798747 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I low I slit2-robo1 798685 n/a 798736 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798695 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I low I robo1-slit3 798685 n/a 798736 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798748 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I low I optc-si:ch211_15p9_5 798685 n/a 798741 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798705 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I low I kdrl-fgfr4 798685 n/a 798738 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798693 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I low I kdrl-fgfr1 798685 n/a 798749 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798693 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I low I kdrl-a8bbf9 798685 n/a 798750 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798693 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I low I dcn-boc 798685 n/a 798751 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798711 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I low I dcn-sid4 798685 n/a 798751 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798718 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I low I bgn-sid4 798685 n/a 798697 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798718 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I low I optc-q6nw92 798685 n/a 798708 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798705 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I low I optc-sid4 798685 n/a 798705 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798718 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I low I optc-pdgfrl 798685 n/a 798705 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798721 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I low I epyc-boc 798685 n/a 798707 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798711 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I low I epyc-fgfrl1a 798685 n/a 798707 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798725 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I low I epyc-sid4 798685 n/a 798718 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798707 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I low I epyc-pdgfrl 798685 n/a 798707 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798721 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I low I chad-sid4 798685 n/a 798744 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798718 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I low I chad-pdgfrl 798685 n/a 798744 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798721 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I low I ch1073_44m10_2-sid4 798685 n/a 798752 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798718 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I low I sc:d0320-sid4 798685 n/a 798718 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798753 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I low I a8bbf9-q6nw92 798685 n/a 798750 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798708 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I low I a8bbf9-sid4 798685 n/a 798718 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798750 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I low I a8bbf9-pdgfrl 798685 n/a 798750 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798721 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I low I chad-q6nw92 798685 n/a 798744 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798708 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. J low J dcn-pdgfrl 798685 n/a 798751 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798721 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. J low J nitr14b-optc 798685 n/a 798722 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798705 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. J low J fgfr2-lrrtm1 798685 n/a 798712 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798714 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. J low J fgfr2-fgfrl1a 798685 n/a 798714 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798725 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. J low J lrrtm1-pdgfrl 798685 n/a 798712 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798721 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. J low J sc:d0340-q6nw92 798685 n/a 798708 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798696 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. J low J sc:d0341-hapln2 798685 n/a 798710 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798746 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. L low L sc:d0340-hapln2 798685 n/a 798696 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798746 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. L low L epyc-lrrtm1 798685 n/a 798707 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798712 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. H low H fgfr2-kdrl 798685 n/a 798714 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798693 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. H low H bcan-kdrl 798685 n/a 798693 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798717 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. H low H fgfr3-kdrl 798685 n/a 798693 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798726 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. H low H q6nw92-lingo1 798685 n/a 798745 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798708 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. H low H hapln2-lrrtm1 798685 n/a 798746 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798712 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. H low H bgn-lrrtm1 798685 n/a 798712 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798697 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. H low H q6nw92-chad 798685 n/a 798744 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798708 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. J low J pdgfrl-dcn 798685 n/a 798721 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798751 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. J low J optc-nitr14b 798685 n/a 798705 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798722 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. J low J lrrtm1-fgfr2 798685 n/a 798714 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798712 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. J low J fgfrl1a-fgfr2 798685 n/a 798714 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798725 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. J low J pdgfrl-lrrtm1 798685 n/a 798721 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798712 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. J low J q6nw92-sc:d0340 798685 n/a 798696 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798708 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. J low J hapln2-sc:d0341 798685 n/a 798710 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798746 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. L low L hapln2-sc:d0340 798685 n/a 798696 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 798746 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. low author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. L low L flrt3-flrt3 798685 n/a 798750 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 798750 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. B high B lrrc4a-lrrc4a 798685 n/a 798754 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 798754 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. B high B