MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint guymer-2010-1 Intrinsic GTPase activity of a bacterial twin-arginine translocation proofreading chaperone induced by domain swapping. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Guymer D., Maillard J., Agacan MF., Brearley CA., Sargent F. FEBS J. (1742-464X) 2010 Only protein-protein interactions imex curation guymer-2010-2 Intrinsic GTPase activity of a bacterial twin-arginine translocation proofreading chaperone induced by domain swapping. in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Guymer D., Maillard J., Agacan MF., Brearley CA., Sargent F. FEBS J. (1742-464X) 2010 Only protein-protein interactions imex curation guymer-2010-3 Intrinsic GTPase activity of a bacterial twin-arginine translocation proofreading chaperone induced by domain swapping. in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Guymer D., Maillard J., Agacan MF., Brearley CA., Sargent F. FEBS J. (1742-464X) 2010 Only protein-protein interactions imex curation tord_ecoli Chaperone protein TorD JW0983 b0998 torD protein protein ecoli Escherichia coli (strain K12) MTTLTAQQIACVYAWLAQLFSRELDDEQLTQIASAQMAEWFSLLKSEPPLTAAVNELENRIATLTVRDDARLELAADFCGLFLMTDKQAALPYASAYKQDEQEIKRLLVEAGMETSGNFNEPADHLAIYLELLSHLHFSLGEGTVPARRIDSLRQKTLTALWQWLPEFVARCRQYDSFGFYAALSQLLLVLVECDHQNR tord-1 863639 tord_ecoli TorD 863642 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false F2A mint tord-1 863639 tord_ecoli TorD 863642 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false F2A mint tord-1 863640 tord_ecoli TorD 863642 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false F4B mint tord-1 863641 tord_ecoli TorD 863642 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false F2B F2C mint