MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint fahie-2009-1 Side chain specificity of ADP-ribosylation by a sirtuin. in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Fahie K., Hu P., Swatkoski S., Cotter RJ., Zhang Y., Wolberger C. FEBS J. (1742-464X) 2009 fahie-2009-2 Side chain specificity of ADP-ribosylation by a sirtuin. in vitro In vitro deacetylase assay deacetylase assay predetermined predetermined participant predetermined Fahie K., Hu P., Swatkoski S., Cotter RJ., Zhang Y., Wolberger C. FEBS J. (1742-464X) 2009 h11_human Histone H1.1 H1-1 H1F1 HIST1H1A Histone H1a protein protein human Homo sapiens Human MSETVPPAPAASAAPEKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQAASSSKERGGVSLAALKKALAAAGYDVEKNNSRIKLGIKSLVSKGTLVQTKGTGASGSFKLNKKASSVETKPGASKVATKTKATGASKKLKKATGASKKSVKTPKKAKKPAATRKSSKNPKKPKTVKPKKVAKSPAKAKAVKPKAAKARVTKPKTAKPKKAAPKKK sir2_tryb2 NAD-dependent protein deacetylase SIR2rp1 SIR2rp1 Regulatory protein SIR2 homolog 1 SIR2 SIR2-related protein 1 Tb927.7.1690 protein protein tryb2 Trypanosoma brucei brucei (strain 927/4 GUTat10.1) MTEPKLATTHVVGEPTFEGLARFIERNNITKIFVMVGAGISVAAGIPDFRSPHTGLYAKLSRYNLNSPEDAFSLPLLRQQPSVFYNILMDMDLWPGKYCPTTVHHFISLLAKKGMLLCCCTQNIDGLERACGIPESLLVEAHGSFSSASCVDCHAKYDINMARAETRAGKVPHCNQCGGIVKPDVVFFGENLPEAFFNVAGLIEETELLLILGTSLQVHPFADLALMVPSDVPRVLFNLERVGGRMFRFPTDRTPNFRASSYRLSTGNGNGSKISSGDSSNSSSVDGYDQFTLAENDETGVLRDIFFPGDCQVSVRSFAQALGFGEQLDASVREGREIFERTRRREKVVEG mint h12_bovin Histone H1.2 H1-2 CTL-1 protein protein bovin Bos taurus (Bovine) Bovine MSETAPAAPAAAPPAEKTPVKKKAAKKPAGARRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAATGEAKPKAKKAGAAKPKKAAGAAKKTKKATGAATPKKTAKKTPKKAKKPAAAAVTKKVAKSPKKAKAAKPKKAAKSAAKAVKPKAAKPKVAKPKKAAPKKK fragmentation type: fragment Histones H1 are necessary for the condensation of nucleosome chains into higher order structures mint adprh_human [Protein ADP-ribosylarginine] hydrolase ADPRH ADP-ribose-L-arginine cleaving enzyme ARH1 protein protein human Homo sapiens Human MEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRIPFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTAYAVNSRPPLQWGKGLMELLPEAKKYIVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGESAPTFPESFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVISL hist1h1a-sir2rp1 857700 h11_human histone H1.1 857702 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme target enzyme target substrate substrate neutral component neutral component purified purified o96670_9tryp TbSIR2 857703 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified adp ribosylation adp ribosylation reaction adp ribosylation false false false F1 mint hist1h1c-sir2rp1 857700 h11_bovin histone H1.1 857704 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme target enzyme target substrate substrate neutral component neutral component purified purified undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false o96670_9tryp TbSIR2 857703 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified adp ribosylation adp ribosylation reaction adp ribosylation false false false F2B F2C mint hist1h1c-sir2rp1-1 857700 o96670_9tryp TbSIR2 857703 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified h11_bovin histone H1.1 857704 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false adp ribosylation adp ribosylation reaction adp ribosylation false false false F2B F2C mint hist1h1c-sir2rp1-2 857700 o96670_9tryp TbSIR2 857703 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified h11_bovin histone H1.1 857704 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme target enzyme target substrate substrate neutral component neutral component purified purified undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false adp ribosylation adp ribosylation reaction adp ribosylation false false false F2B F2C mint hist1h1c-sir2rp1-3 857700 h11_bovin histone H1.1 857704 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false o96670_9tryp TbSIR2 857703 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified adp ribosylation adp ribosylation reaction adp ribosylation false false false F2B mint hist1h1c-sir2rp1-4 857700 o96670_9tryp TbSIR2 857703 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified h11_bovin histone H1.1 857704 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false adp ribosylation adp ribosylation reaction adp ribosylation false false false F2B mint hist1h1c-sir2rp1-5 857700 h11_bovin histone H1.1 857704 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false o96670_9tryp TbSIR2 857703 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified adp ribosylation adp ribosylation reaction adp ribosylation false false false F3 mint hist1h1c-sir2rp1-6 857700 o96670_9tryp TbSIR2 857703 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified h11_bovin histone H1.1 857704 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false adp ribosylation adp ribosylation reaction adp ribosylation false false false F3 mint adprh-hist1h1a 857700 h11_human histone H1.1 857702 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme target enzyme target substrate substrate neutral component neutral component purified purified adprh_human hADPRH 857705 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cleavage cleavage reaction cleavage false false false F4C homomint mint hist1h1a-sir2rp1-1 857701 h11_human histone H1.1 857702 predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified o96670_9tryp TbSIR2 857703 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified deacetylation deacetylation reaction deacetylation false false false SF2C mint