MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint nakamura-2009a-1 The ubiquitin-like protein monoclonal nonspecific suppressor factor beta conjugates to endophilin II and regulates phagocytosis. mouse-liver Mus musculus liver liver anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Nakamura M., Shimosaki S. nkmr0515@med.shimane-u.ac.jp FEBS J. (1742-464X) 2009 Only protein-protein interactions imex curation nakamura-2009a-2 The ubiquitin-like protein monoclonal nonspecific suppressor factor beta conjugates to endophilin II and regulates phagocytosis. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Nakamura M., Shimosaki S. nkmr0515@med.shimane-u.ac.jp FEBS J. (1742-464X) 2009 Only protein-protein interactions imex curation ubim_mouse Ubiquitin-like protein FUBI Fau Monoclonal non-specific suppressor factor beta protein protein mouse Mus musculus Mouse MQLFVRAQELHTLEVTGQETVAQIKDHVASLEGIAPEDQVVLLAGSPLEDEATLGQCGVEALTTLEVAGRMLGG sh3g1_mouse Endophilin-A2 Endophilin-2 SH3 domain-containing GRB2-like protein 1 SH3 domain protein 2B SH3p8 Sh3gl1 Sh3d2b protein protein mouse Mus musculus Mouse MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKDMEKKVDVTSKAVAEVLVRTIEYLQPNPASRAKLTMLNTVSKIRGQVKNPGYPQSEGLLGECMVRHGKELGGESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFIDPLQNLCDKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILEELADKLKRRVREASSRPKREFKPRPREPFELGELEQPNGGFPCAPAPKITASSSFRSSDKPIRMPSKSMPPLDQPSCKALYDFEPENDGELGFREGDLITLTNQIDENWYEGMLHGQSGFFPLSYVQVLVPLPQ fau-sh3gl1 854522 ubim_mouse MNSF beta 854524 predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level sh3g1_mouse Endophilin-2 854525 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f3b mint fau-sh3gl1-1 854522 ubim_mouse MNSF beta 854524 predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level sh3g1_mouse Endophilin-2 854525 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f3b mint fau-sh3gl1-2 854523 sh3g1_mouse Endophilin-2 854525 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey partially purified partially purified ubim_mouse MNSF beta 854524 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role bait bait partially purified partially purified physical association physical association false false false mint f1 t1 t2