IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ sollner-2009-1 A cell surface interaction network of neural leucine-rich repeat receptors. in vitro In vitro solid phase assay solid phase assay tag visualisation tag visualisation Soellner C., Wright GJ. AVEXIS classifications were used for mapping confidence. The classifications are: A - Homophilic interaction seen in both the primary and validation screens. B - Homophilic interaction positive in either the primary or validation screen. C - Heterophilic interaction positive in both bait-prey orientations in the primary and validation screens. Positive 4 out of 4 times tested. D - Heterophilic interaction positive in both bait-prey orientations in either the primary or validation screens. Positive 3 out of 4 times tested. E - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; positive in both orientations in the validation screen. Positive 3 out of 3 times tested. F - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; also positive in one orientation only in validation screen (both orientations tested) but in different orientation to the primary screen. Positive 2 out of 3 times tested. G - Heterophilic interaction positive in one bait-prey orientation only in both the primary and validation screen. Positive 2 out of 4 times tested. H - Heterophilic interaction negative in both bait-prey orientations in the primary screen but positive in both orientations in the validation screen. Positive 2 out of 4 times tested. I - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; positive in only the same orientation in the validation screen (both orientations tested). Positive 2 out of 3 times tested. J - Heterophilic interaction negative in one bait-prey orientation in the primary screen but other orientation not tested; positive in both orientations in the validation screen. Positive 2 out of 3 times tested. Interactions were considered as high confidence when identified in the first screen and detected in both bait-prey orientations (classes A, C, D, E and F). 2009-02-12: GJ Wright, The Wellcome Trust Sanger Institute, Hinxton, UK. AVEXIS a novel solid phase assay (MI:0892) to detect surface interactions was used. Ectodomains bound to rat CD4 domains 3+4 were expressed in HeLa-293E cells as a monomeric biotinylated bait, which could be captured on streptavidin-coated microtitre plates, and a pentamerised prey tagged with beta-lactamase to allow detection. The nucleotide sequence accession numbers provided were used to determine the UniProtKB Accession numbers. gw2@sanger.ac.uk Genome Biol. (1465-6906) 2009 Only protein-protein interactions imex curation sollner-2009-3 A cell surface interaction network of neural leucine-rich repeat receptors. in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs predetermined predetermined participant predetermined Soellner C., Wright GJ. AVEXIS classifications were used for mapping confidence. The classifications are: A - Homophilic interaction seen in both the primary and validation screens. B - Homophilic interaction positive in either the primary or validation screen. C - Heterophilic interaction positive in both bait-prey orientations in the primary and validation screens. Positive 4 out of 4 times tested. D - Heterophilic interaction positive in both bait-prey orientations in either the primary or validation screens. Positive 3 out of 4 times tested. E - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; positive in both orientations in the validation screen. Positive 3 out of 3 times tested. F - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; also positive in one orientation only in validation screen (both orientations tested) but in different orientation to the primary screen. Positive 2 out of 3 times tested. G - Heterophilic interaction positive in one bait-prey orientation only in both the primary and validation screen. Positive 2 out of 4 times tested. H - Heterophilic interaction negative in both bait-prey orientations in the primary screen but positive in both orientations in the validation screen. Positive 2 out of 4 times tested. I - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; positive in only the same orientation in the validation screen (both orientations tested). Positive 2 out of 3 times tested. J - Heterophilic interaction negative in one bait-prey orientation in the primary screen but other orientation not tested; positive in both orientations in the validation screen. Positive 2 out of 3 times tested. Interactions were considered as high confidence when identified in the first screen and detected in both bait-prey orientations (classes A, C, D, E and F). 2009-02-12: GJ Wright, The Wellcome Trust Sanger Institute, Hinxton, UK. AVEXIS a novel solid phase assay (MI:0892) to detect surface interactions was used. Ectodomains bound to rat CD4 domains 3+4 were expressed in HeLa-293E cells as a monomeric biotinylated bait, which could be captured on streptavidin-coated microtitre plates, and a pentamerised prey tagged with beta-lactamase to allow detection. The nucleotide sequence accession numbers provided were used to determine the UniProtKB Accession numbers. gw2@sanger.ac.uk Genome Biol. (1465-6906) 2009 Only protein-protein interactions imex curation sollner-2009-2 A cell surface interaction network of neural leucine-rich repeat receptors. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Soellner C., Wright GJ. AVEXIS classifications were used for mapping confidence. The classifications are: A - Homophilic interaction seen in both the primary and validation screens. B - Homophilic interaction positive in either the primary or validation screen. C - Heterophilic interaction positive in both bait-prey orientations in the primary and validation screens. Positive 4 out of 4 times tested. D - Heterophilic interaction positive in both bait-prey orientations in either the primary or validation screens. Positive 3 out of 4 times tested. E - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; positive in both orientations in the validation screen. Positive 3 out of 3 times tested. F - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; also positive in one orientation only in validation screen (both orientations tested) but in different orientation to the primary screen. Positive 2 out of 3 times tested. G - Heterophilic interaction positive in one bait-prey orientation only in both the primary and validation screen. Positive 2 out of 4 times tested. H - Heterophilic interaction negative in both bait-prey orientations in the primary screen but positive in both orientations in the validation screen. Positive 2 out of 4 times tested. I - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; positive in only the same orientation in the validation screen (both orientations tested). Positive 2 out of 3 times tested. J - Heterophilic interaction negative in one bait-prey orientation in the primary screen but other orientation not tested; positive in both orientations in the validation screen. Positive 2 out of 3 times tested. Interactions were considered as high confidence when identified in the first screen and detected in both bait-prey orientations (classes A, C, D, E and F). 2009-02-12: GJ Wright, The Wellcome Trust Sanger Institute, Hinxton, UK. AVEXIS a novel solid phase assay (MI:0892) to detect surface interactions was used. Ectodomains bound to rat CD4 domains 3+4 were expressed in HeLa-293E cells as a monomeric biotinylated bait, which could be captured on streptavidin-coated microtitre plates, and a pentamerised prey tagged with beta-lactamase to allow detection. The nucleotide sequence accession numbers provided were used to determine the UniProtKB Accession numbers. gw2@sanger.ac.uk Genome Biol. (1465-6906) 2009 Only protein-protein interactions imex curation a8bav6_danre lrrtm2 sc:d0320 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MGFHSRWPLVGQAPAALCVISMLLCLPPVSCTTCPQKCRCEDLQFYCDTQGLLAPPDGVDKGALGLSLRHNSISELSSDQFFGFTQLTWLHLDHNQITTVHEDAFQGLYKLKDLNLSSNRITKLPNTTFIHLINLQILDLSFNQMTALEPELFHGLRKLQILHLRSNSLRTTPVRAFWDCRSLEYLGLSNNRLRSLARNGFAGLIKLRELHLEHNHLTKINLAHFPRLVALQFLYLQWNKINNLTSTMEWKWTTLEKLDLTGNEIRVLIPEVFETLPSLKILLLDNNKLSNLDSQTMDMWKSLNVIGLSSNLWECTKRICNLATWLSTFKGRWEHSILCYSPEYAQGEEILDAVYGFQLCQNFSAPVVLTSTSTEAMLPDITSSLFGNMQTPTQDFYAEDFGSFTIVTTTTTTTQPPRTALATTMTVEGADVTEDYSAMDNTLLTQR a8bbg3_danre lrrtm1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MLMDFLLIGLYLKWPLRKPPGLILCSLGIVLKIVPLVGGSCPRLCRCDNKQLYCEGLNLTDIPQNLSSAIGLSLRENNISELREGNFVGLSQLTWLYLDHNNIEIVEESAFERLRRIKELDLSTNRIESLPNGTFRPLPNLRILDLSYNRLQSLEPDLFHGLRKLTNLHLRYNALKFIPVRIFQDCRSMQFLDLGYNQLQSLARNSFAGLFKLTELHLEHNELVKVNLAHFPRLISLRTLYMRNNKATIVVNTLEWTWDYLEKIDFSNNEIEYIEPHVFESVPKLNTLMLDSNKLTYIDQRILDSWTSLSSITLSGNDWECSRNVCALASWLSNFQGQRDSGLLCANPDIAQGEDILDAVYAFQLCEDNVEATTQTFTVTRNRPRGFIYEGPTKNPYDLQDMEGGEVVTNSLTVTASGDDLESTMKIHK a8bbf0_danre flrt1a sc:d0372 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MMAPEGIGELRDLLFLLLLCFTLLAELLEMTAASSQGLDGEDDIVCPSVCRCDEDFIYCNDRGLSAIPPLPPSATVLYLQNNHIDNAGLPRSLEYHTTVRVIYLYDNELDDFPMHLPPSIRELHLQDNNIRVLPRAALARLPLLEKLHLDDNSVSTVSIEDQAFADNPRLRLLFLSRNHLSSIPSGLPASLEELRLDDNRISTIPTHAFRGLSSLRRLVLDGNLLANQRIADDTFSRLSNLTELSLVRNSLQTPPLNLPSAHLQRLSLQDNNLIHVPRGSLDGMRRLQRLDLSGNNLTTLPRGLFRDLDTLGQLLVRGNPWHCGCNLRWLHDWLEAKGNTITVRGFICLTPERVRDMALRDLTNQMDECELAAAGGGGVGAGVGVGGNRMSGGAVSTTLSPPQGSLFTLRSKRPGLGLPDSGLDYTLSSSGVGKNLALNVKPLSHDSIRVTWSVAQTSSSFRLSWLRLGTSSAMGSITETLVRGDRREYLLTSLQPASSYIICMVPLVSNSGSRSGLPGGDAESNDVPVCARTETSDPNQPDDEQGETEGSDQMTSLP a8bb40_danre lrrtm4l1 sc:d0341 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MGSLACDMRLAGLLLLQASSLLLFSSGERMCPYSCHCEGKIVHCESSAFQDIPENISVSCQGLSLRYNDLHTMLPYQFAHLNQLLWLYLDHNQIMFVDSRAFQGLRRLKELILSSNRISQLHNVTFHGVPNLRSLDLSYNKLQELQPGQFYGLRKLQNLHLRSNGLTAIPVRAFLECRSLEFLDLGYNRLRVLTRTAFLGLSRLMELHLEHNQFSRINFFLFPRLANLRALYLQWNRIRAVNQGLPWSWYTLQRLDISGNEIQVLDPVVFQCLPNLQVLNLESNKLANVSQEVVAAWISLTTISLAGNMWDCGPGICPLVVWLKNFRGTKDTNIICSSPKHLQGEKVIEASKNYIDCDDYESTAQSPLYLQTFDPNYDLALEPTEPTMAPTTPPPPLPSPASEAPFPPSQSRPPHRPTFPSRTNTDPRDSHQRTPSSFDSSLVTPVPEQDNVSFHK a8bb35_danre lrrtm4l2 sc:d0340 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MGPLLWEGCLSCFLLHASVLLLLSKGERMCPVSCRCEGKIVYCESGGFQDVPENISLGCQGLSLRYNSLLLLLPYQFAHLNQLVWLYLDHNSISTVDRLAFQGLRRLKELILSSNKIAQLQNGTFETVPNLRNLDLSYNQMQDLVPGHFHGLRKLQNLHLRSNNIRSIPVRTFMECRSLEFLDLGYNRLRTITRTTFLGLLRLTELHLEHNQFSRINFFLFPRLLNLQALYLQWNRIRTVVQGSPWTWHTLQKLDLSGNEIQILDPAIFRCLPNLHTLNLESNKISNVSLEVVSSWISISTINLAGNIWDCSSSICPLVSWLRNFRGTRDASIICSTPKSLQGERVMDAVRNNSVCEEMFTVEPTTELTLLLTTTTTTLYVTKPPTTTTTTPRTTTRQLSQVTHIQRLTPKVLLPVRPEKEFLTVTPSSLPFTPEPEFEHMTFHK a8bbj6_danre lrrc4ca lrrc4c protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MINKMTSSLMQQTMRGPRWNRALSDPLFVLSLALQLLVVAGLVRAQTCPSVCSCSNQFSKVICTRRGLRDVPDGISTNTRYLNLQENLIQVIKVDSFKHLRHLEILQLSKNHIRNIEIGAFNGLANLNTLELFDNRLTTIPNGAFEYLSKLKELWLRNNPIESIPSYAFNRVPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLGMCNLKEIPNLIPLVRLDELEMSGNQLSIIRPGSFKGLVHLQKLWMMHAQIQTIERNAFDDLQSLVELNLAHNNLTLLPHDLFTPLHHLERVHLHHNPWNCNCDILWLSWWLKEMVPANTSCCARCSSPTSHKGRYIGELDQNYFHCYAPVIVEPPADLNVTEGMAAELKCRANSLTSVSWITPNGSIMTHGAYKIRISVLNDGTLNFTNVTMQDTGTYTCMVSNSAGNTTASATLNVSSTENSSFSYFTTVTVETTEAPPDEGHPTVQQKNGPTPSSGIWETLPPSFTTTTTTARTPLSTKATDKTYTIPVTAQSDGSLNTLDEVMKT a8bb75_danre lrrn1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MARGTFFLVVEGQICFILLLAVLGLSSVHSTECPQLCVCEIRPWFTPQSTYREATTVDCNDLHLTRIPGNLSADTQVLLLQSNYIARTSEELEQLLNLTELDLSQNNFSNIRDIGLTNMSQLTTLHLEENQIVEMPDFSLQDLTNLQELYINHNQISSIAPNAFAGLRNLLRLHLNSNRLKAIDSRWFESTPNLEILMIGENPVVGILDLNFKPLTNLRSLVLAGMELTDIPGNAFVGLDNLESLSFYDNKLVRVPQTALQKLPNLKFLDLNKNPIHKIQEGDFKNMLRLKELGINNMGELVSIDRFALDNLPELTKLEATNNPKFSYVSRLAFRDLPALESLMLNNNALNSLYQATADSLPNLREISIHSNPLRCDCVIQWMSSNKTTIRFMEPLSMFCTMPIEVRGQRVRDVFSREPSGQCLPMISHDTFPNHLNLDIGMTVDLDCRAMAEPEPEIYWVTPSGNKVMMDTVSDKYQLNSAGTLRISYIQVDDSGHYTCVAQNTEGADTRVTAIRVNGTLLDSTQLMKIYVKHTESHSILVSWKVNSNVMTSNLKWSSATMKIDNPHITYTAKVPVDVHEYNLTHLQPATEYEVCLSVSNIHQQTQKSCVNVTTKHATFAVEISEQGTNT a4jyh4_danre unc5b protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MLSTCIHRDQSPASLLGLLLLSSTLVIHADGSDYSEVLPDSFPSAPAEPLPEFQSEPEDAFIVKNRPVKLSCKAAPATQIYFKCNGEWVNQNDHVTKESLDHITGLVVREVDISVSRTQVEELFGLEDYWCQCVAWSSAGTTKSRRAYVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPEGSPPAEVDWLKNEELIDPALDSNFLITIEHDLIIKQARLSDTANYTCVARNVVAKRRSSTATLIVYVSGGWSSWTEWSECNAQCGRGWQRRTRSCTNPAPLNGGAFCDGPPFQRVTCTTLCPVDGGWTEWAKWSACGTECTHWRSRECQAPPPRNGGRHCSGSMMESKNCTEGLCARNKKVSVEHTSHPLGSGTG a8bav0_danre flrt1b sc:d0318 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MATESLVELRDWLFLLLLCLTLLVEVLEFAAATAAAAEAALGEAELQGEVPCPSACRCDDGFIYCNDRGLTLIPPLPLTAAVLYLQNNRIDNAGLPTSLERRLTVRVVYLYDNELDDFPTHLPPSLRELHLQDNNIRTLPRSALARLPLLEKLHMDDNSISTVSIEDKAFTNNPRLRLLFLSRNHLSSIPSGLPASLEELRLDDNRISTIPTHAFRGLSSLRRLFLDGNLLANQRIADDTFSRLSNLTELSLVRNSLQAPPLNLPSLHLLRLYLQDNAIAHMPRGSLDGMRRLQKLDISGNNLTTLPRGLFKDLDSLSQLLVRGNPWYCGCNLRWLHDWLHERGSSVTVRGLTCHAPERLRGMALRDLSSQLEDCEVTVDAAGGMVGNEVAKKEKGYFPTQPPATTTPPLPQGSLFTLRSRRPGHKYSDMGQDSLGGGNGFVSKSLLISVKPLTPETVHITWQAAQPVPSFRLSWLRLGNSPAMGSITETLVPGDRREYLLTQLQPQSSYIICLVPLAGNDGKRTSFTATGGLNINTNSEHEHPACAKTETDPLEQPMSDQDSDRGTDALSALP a8bb27_danre vasna vasn protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MRPLSPLSHLILLQLLCGCLSSRCPHDCTCLPSNNIFCVQRNLIYMPRGLPSTGKQLYVFQNKINILQQQDFVELGELEMLDLSQNSLSEIPDGVFSPLSSLHNLDLSSNYITHISKDSFIGLVNLERLYLYSNIIQNIHPAAFEGLENLLELKLQGNQISVLPALQLPRLLHLDLSYNSIPPLVAQDLQTPHLESLKIAGLGLTSLDEELLGSLVNLHVLDVSQNQLVDIQPTLKSMGGLRNLNLTGNPLGSLKHEDFQNLVNLLELDLSNLNLQGFPEEFFNLFPKLEKLTAAENPFNCLCPLAWFPAWLKDVRVELLRTEETRCHFPPINSGKVLEKLEHKDFGCPTTTIELTSAGTSSTTSKPTNSSTQSGTTHIVPPAPPSDISSADADNFPVYQTTAFPSRIMEDSEGKGIMCPPNICLNGGTCIFKSNGVIVCLCPPSMSGNYCEIQNEAMLPPPSPRVSLETIATVQPNTISSHHITSTSISLDLHRYIQTRPHIRGIRLTYSNLSGPDRRPLQLSVPPSYPEYTLRGLQPNSTYSVCASPLGEPVHASVSACMEARTAGIPPSSHEPSVDRTEP a8bbf4_danre islr2 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MATKYLMLIALGTALIGNAHCCPKQCACSDKYNHQFVDCAYKDLVEVPVGLPSNASTLSLSANKIKVLKSKTFVNVTQVTSLWLAHNEIITVERDTLAPLIQLKNLDISNNKIVHFPWEDLANLGALQLLKMNNNEMVSIPKNAFSNLKDLRSIRINNNKFTTIVQGTFDSLAAMSHLQIFHNPFICSCNLEWLRDWILKSSISIPEQNNIACDAPSHLKGSQVTSMPKLNCKAPSVSITYQPNIEKTELYEGYMVMLYCETKGTPKPEVTWEIFAGNQLITFPLPAIVEKSDIPINGPPTNTRFLVFQNGTLIVPRMSKKEEGNYTCSAVNDIGKAESSVRLVVAGTKKHATNSMLDTKSPGLLPEDKLGSKGSKNSVISMRPKFEEKTKSLPTGTSVITVDKEQVDEGADTLPFVGKCGINDGTQYISNHAFNLSLDELKQYTFDFGVIALEVSETEAKVQLNPMQMANAKSNIHLSQQQDLQTVNKEPFSLFQTSAKKSPLDLLYLCVSTGNGHSVVQWSKIEEGVNAYRFQHLKPGTNYTLCLTYGGQDCQVQVVFTTRKKIP a8bbf9_danre flrt3 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MASNYMSFFVFFIRAGLLLGLANPLMTSASCPSQCRCDGTFIYCNDRDLTSIPSGIPEDATVLFLQNNRIKSAGIPTDLRRLNGVEKIYLYCNNLDEFPTNLPLNVKELHLQENNIRTITHASLAQIPFIEELHLDDNSVSAVSIEEGAFRDSNHLRLLFLSRNHLSTIPSGLPMTIEELRFDDNRISSISEASLQDLINLKRLVLDGNLLNNRGIGEMALVNLVNLTELSLVRNSLTSPPANLPGSSLEKLNLQDNHINHVPPGAFAFLRQLYRLDLSGNNLSSLPMGVFEDLDNLTQLLLRNNPWHCNCRMKWVRDWLRTLPSKVNVRGFMCQGPDKVKGMAIKDLSTELFGCSDTEIPTTYETSTVSNTLPPSRPQWPSYVTKRPVVKGPDLGRNYRSTTPSSRKIITISVKSSSAETVHISWRVSQPMTALRLSWLKLGHSPAFGSITETIVQGERTEYLLTALEPESSYRICMVPMETSNIYLSDETPVCIETETGSLKAYNPTTTLNREQEKEPYKNSNLP a4jyg1_danre fgfrl1b protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MFPERGSLAFLSVLIVALSCEARGPPSVSRPVENRQTAKLGCTVRIPCPVEGDPPPLVLWVKDGRNVNPGWSRYKVLKQSLKIKEVELEDAGVYICRVTNGFGSLALNFTLIVIDDAAVPQNPPPPDAAEPNADLSLQEPTREPWVKPRFSQPTKMRRRVLEQPVGSSVRLKCLASGNPTPVITWWKDQSLLDNPQQSKRPQWTLTLKNLQPQDSAKYTCHVSNAAGHINATYKVDVIERTNSKPILTGTHPVNTTVEFGGTASFQCKVHSDVKPVIQWLKRVDPGSEDRYNSTLEVGGQHYVVLPTGDVWSRPDGSYLNKLAIVKARDEDAGMYICLGANTMGYSVRSAYLTVLSDPKVEKDVIPRHISPGLP a8bbg8_danre elfn2a ch1073-44m10.2 elfn2 sc:d0398 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MACGISLPCAVPTSFLILSLPIFLLFHAPSFVRGDCWLIEGDKGYVWLAICSQNQPPYETIPQHINNTVHDLRLNENKLKAIFFSSLSRFTNLTDLNLTKNEISYIEDGAFAGQANLQVLQLGYNKLTNLTEGMLRGLGRMQCLYLQHNLIEVIATNAFWECPSLSSLDLSSNKLAKLDASTFTVLGGRLIVCELAGNPFHCGCDLYTFLIWLEAFDNVTHTYDRLLCETPKELFGYPLVSPRGNHGRNARSILSSMCKDGVIVGGITALPPDLDSSGMEIDFYDQMGPHMQPTASSTTDPTYSPNIKLQTVSFSTASLLVQIPKPYSKMYILVQYNHTYVSDVINLKNKKQTVTLNDLKPHTNYTFCVASIRNSQRYNHTCLNFATRAPGPDDLRAGRSTTT a4ig39_danre zgc:162186 igsf21b protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MSVITLSLLLCADLLDFVIGYLTVTIEPLPPVVMGDTVTLKCNFRTDGNLREIVWFRVTEGGTSKQKIFTYDAMYNTNFSHMEDFRRREDLVYQSTVRLPEVQMEDDGPYECHVGIYDRASREKVVLASGSITLNVMSPPKSIFVEAANQPARFNRYEAQNFTLVCIVTGGKPAPVVYFKRDGEVIEVHPFASSEKVENRGLLAPKDNQPLISRELDDTKVQKSLSFMGPYSEPVRLDKDRPQRSYTSGAPTHEEPSPTTEVIPETVISREFPRWVLSSSPLYFFNQTQSELHDGTLEVQAMLTWHLNPQLDNEALFSCEVKHPALSMPMKAEVTLSAPKGPKLSVAPSRAKVGDTVRIKVEGFQMGPKANEVFPEPLFTWTRVGGPLLDGSEERFGKELVLERVPAELNGSMYRCTVQNPLGSTNTHTRLIVFENPKIKKEPTQMNFGNSARDMLGPSLMMMMLLSLTLEFT a4jyd4_danre boc protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MSGTLNWIPWERKRKIRVLCSLCVLLFCLQDSNAVTDDVPVFTEEPFSVVQKLGGSVTLRCSALPNHVNISWHLNGRELPAGGDEELGVLVRPGSLYIPSLTNLTVGRYQCVATTSVGSCASVPANVTAAKLRDFEPDDQQEIEVDEGNTAVIECHLPESQPKAQVRYSVKQEWLETSKGNYLIMPSGNLQIANATRDDEGPYICAAYNPVTQEIKTSTSTDRLRIRRSTSEAARIIYPPASRSIMVNKGQRLVLECVASGIPTPQVTWAKDGLDLRNHNNTRFLLSNLLIDAASESDSGTYVCLADNGIGSTSSAQVLYDVQVFEPPQVRVELQQQDVAWGDTVRFSCQVRGKPAPTVVWLHNAQPLSPSPRHRVSAQVLRVLNVGPQDDGMYQCMAENGVGSSQAATRLLTLPTVPSRKMPMIRPLSPDKVLREQPPLKPPVSTSAVLPFDCSEVRVSPAEAPVILSQPRTGKADYYELTWKPRHDGGAPVLEYIIKYRKAGESPGEWTTNTISGSQHKLILTKLQPASLYEVEMAARNCAGLGQPAMMTFRTGKWRRGGPIGPPKTPVVQPRLSPPEAPDRPTVSMATETSAYVTWIPRGNRGFPIQSFRVEHKKLRKGSGDWEVAVNNIPPSRLSVEVTGLEKGTSYKFRVLAVNVLGASPPSAPSKAYTVVGSGPPNRRPIDGPYITYNEAINETTIILKWTYTPLNNTPIYGFYIFYRPTDSDNDSDYKKDVVEGDRYWHSITDLQPETAYDIKMQCFNEGGESEFGNVVILETKARPHQRTTPPETASSRPEHPGNPVPRPGDLPYLIVGVVLGAFVFIIVAFIPICLWRVWAKQKQTLDMRFPTLAATVSPCQYTMVPL q7sx76_danre fgfrl1a protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MELLWIVFFIFDIIFITDCARGPPRVAEKIAHRQTVRIGRTMKLQCPVEGDPPPLIMWTKDGRNIHSGWMRFRVLQQALRIKEVEADDAGTFICKATNGFGSVNINYTLIVIDDSSAGREGARPAGETEYSTDLTGKLVRPRFTQPAKMRKRVIARPVGSSVRLKCTASGNPRPDIVWLKDSRPLTPEEVGEGRKKKWTLSLKNLTPEHSGKYTCHVSNRAGEINATYKVEVIQRTNSKPILTGTHPVNTTVDYGGTTSFQCKVRSDVKPVIQWLKRVEPGGEGKYNSTIEVGDHHFVVLPTGDVWSRPDGSYLNKLLITRAKEEDAGMYICLGANTMGYSFRSAFLTVLPDPKPPFSPIPSVLPPSLPWPVIIGIPAGIVFILGTVLLWFCQSRKHCSSGAIISAQTLPNGHRQPPRDRPADKDCIASVAYEEYLAQQQQQQLLLAQSAPKVYPKIYSDIHTHTHSHVDGKIHQHQHIHYQC q3mkm9_danre vasna slitl2 vasn protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MRPLSPLSHLILLQLLCGCLSSRCPHDCTCLPSNNIFCVQRNLIYMPRGLPSTGKQLYVFQNKINILQQQDFVELGELEMLDLSQNSLSEIPDGVFSPLSSLHNLDLSSNYITHISKDSFIGLVNLERLYLYSNIIQNIHPAAFEGLENLLELKLQGNQISVLPALQLPRLLHLDLSYNSIPPLVAQDLQTPHLESLKIAGLGLTSLDEELLGSLVNLHVLDVSQNQLVDIQPTLKSMGGLRNLNLTGNPLGSLKHEDFQNLVNLLELDLSNLNLQGFPEGFFNLFPKLEKLTAAENPFNCLCPLAWFPAWLKDVRVELLRTEETRCHFPPINSGKVLEKLEHKDFGCPTTTIELTSAGTSSTTSKPKNSSTQLGTTHIVPPAPPSDISSADADNFPVYQTTAFPSRIMEDSEGEGIMCPPNICLNGGTCIFKSNGVIVCLCPPSMSGNYCEIQNEAMLPPPSPRVSLETIATVQPNTISSHHITSTSISLDLHRYIQTRPHIRGIRLTYSNLSGPDRRPLQLSVPPSYPEYTLRGLQPNSTYSVCASPLGEPVHASVSACMEARTAGIPPSSHEPSVDRTEPSSSLTPIVVAVAVVMVVAIIATVVVISRRRRPKAPVDMDLHETSPLEMEGVKTNPENGLTHPKQPDITPCSSLAPNSLEYDVLLIQGQGQCPANNNIDCTKALYV q5k374_danre fgfrl1b fgfrl1b alpha DKEY-149K8.2-001 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MFPERGSLAFLSVLIVALSCEARGPPSVSRPVENRQTAKLGCTVRIPCPVEGDPPPLVLWVKDGRNVNPGWSRYKVLKRSLKIKEVELEDAGVYICRVTNGFGSLALNFTLIVIDDAAVPQNPPPPDAAEPNADLSLQEPTREPWVKPRFSQPTKMRRRVLEQPVGSSVRLKCLASGNPTPVITWWKDQSLLDNPQQSKRPQWTLTLKNLQPQDSAKYTCHVSNAAGHINATYKVDVIERTNSKPILTGTHPVNTTVEFGGTASFQCKVHSDVKPVIQWLKRVDPGSEDRYNSTLEVGGQHYVVLPTGDVWSRPDGSYLNKLAIVKARDEDAGMYICLGANTMGYSVRSAYLTVLSDPKVEKDVIPRHISPGLPWPLIIGIPAAALLIVGTIVLWLCHSRRRQSALPPRPTTYRDHHISDKEPSSPNTNKPDLPSHRLATGPATLSGPPKIYTKVYTDMHTHTHTHAHMEGKVHQHFHYQC q90z69_danre robo3 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MEFRRTLDALVVVFALICLSQGSRPRLEDAAPRIVEHPSDLIVSKGEPATLNCKAEGRPTPMVEWYKDGERVETDREDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGVYVCVARNYLGEAVSRNASLEVAILRDDFRQTPSDVVVAAGEPAVMECIPPRGHPEPTISWKRNNVKVNDKDERITIRGGKLMISNTRKSDAGMYVCVGTNMVGEKDSDPAELVVFERPMFVRRPVNQVVLADDTVDFQCEVQGDPAPTIRWKKEEGELPRGRFEIRADNSLRLTQVKAEDEGSYTCLSENSVGKAEASGSLQVHVPPQIVVRPRDQISAQGRTVTFLCGTKGNPPPAVFWQKEGSQVLLFPSQPPSQSGRFSVSLSGELTITDVHSEDSGYYICQAISVAGSILTKALLEVESTPSDRIPPIIRQGPANQTLAPGTTAQLQCHVMGNPLPSIQWERHGQRILGIDERISLMENGTLQITALQETDSGAYTCVASSLSGETSWSGVLTVKESGGLSASPVSEPYQLPGPPQKPVVTDVTRNSVTLTWQPNAHEGGAAVTSYIIEAFSQSAGSTWQTVADFVKLEKHTVTGLSPNTIYLFIVRAVNAYGLSDPSPISEPVRTQDVSPTGQGVDHRQVQRELGEMSVQLHEPVLLTASSVKISWNVDRQSQYIQGYRLLYRPVGGSWSQQEVKGATERSAVIANLLKGTEYEIKIRPYFNEFQGLDSRSQTLRTPEEVPSAPPRAVNVATVKLSNSSSISVSWQPPPTDMQNGVIQEYKVWCLGNDSQTRYNINQTVDGSVLSTVLKGLLPGVLYQVEVAAVTSAGVGKHSQPVSVLIKLPAEQPTVTGGGSESEENVSLAEQITDVVKQPAFIAGIGGACWVILMGFSVWIYCRRKKRKELSHYTASFAYTPAVGFPHGESSGLNGRPGMLGANMGNYPWLADSWPTTNLVHNGKDSVNCCTSKHETPERYYNEAGISNYLNQNEKYSADSNEGPIYSTIDPTSEDLRSFTAQYSQHTTPYASTPIMPFTNQAPCSPEQDGSHWMTQPGTSNAQYAQPDRSKTENVKQPKQKLMGKPVKTPSLNWMDALPPPPISGDLEQCDEEDDNELIQDMGSDEEEWCPPLPERSYLMDGMVEDGPVPPPRGEASSPTTSYSHQSTATLTPSPRDDGHFHDIPRLHQLEQPHMTRRLPCGPVPVPRAPSPPLTQSNPNLSANQECPDNTVPHRSAHKRDLSQGAAQSVENISNTTPGRARPSADHTPSGQKSKVKKKASKSAQYRRDILQGDLPPPPEPPPEDQDNCAHVGGFECGQTSLERAGSSNSSMERREQSTPNRKNSAHRRIDADDDLIPYNKPNFLSRGQMSSNCSTTGSSSSRGSTGSRGQGTGRKRNDEMR a8bbd5_danre elfn1b elfn1 sc:d0369 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MTEAQMSISSGSNGHRGGMVTSALLCWAVALVFLSLTRVPVVQGDCWLIEGEKGFVWLAICSQNQPPYENIPMHINSTIVDLRLNENKIRSIHFSSLSRFGNLTYLNLTKNDISYIEDGAFSAQFNLQVLQIGFNKMRNLTEGMLRGLGRLQYLYLQANLIETVTANAFWECPAIENIDLSMNRIQQLDGATFRGLSKLTTCELYANPFSCSCELLGFLRWLVAFPNRTSERMACDTPAGFSGYSLLSQNPRMPRYRNAFHALSSVCTDDNVTPYLHGSPDGGIPTRLPDLSPCGLDDCSSGTFPEETISISPTFLDSDARPIMKLKEVTHTSAVITIQIPNPFRKMYILVLYNNSFFTDIQNLKSQREEIELQNLKSHTNYTYCVASIRNSLRFNHTCLTISTGPRTLQERVVNDSTAT a4jyd3_danre robo3 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MLRYLIKTLLQMNLFTDTIRDATNGTDLFFNISSIPSFNSSLLDWANFTGLNGSRPRLEDAAPRIVEHPSDLIVSKGEPATLNCKAEGRPTPMVEWYKDGERVETDREDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGVYVCVARNYLGEAVSRNASLEVAILRDDFRQTPSDVVVAAGEPAVMECIPPRGHPEPTISWKRNNVKVNDKDERITIRGGKLMISNTRKSDAGMYVCVGTNMVGEKDSDPAELVVFERPMFVRRPVNQVVLADDTVDFQCEVQGDPAPTIRWKKEEGELPRGRFEIRADNSLRLTQVKAEDEGSYTCLSENSVGKAEASGSLQVHVPPQIVVRPRDQISAQGRTVTFLCGTKGNPPPAVFWQKEGSQVLLFPSQPPSQSGRFSVSLSGELTITDVHSEDSGYYICQAISVAGSILTKALLEVESTPSDRIPPIIRQGPANQTLAPGTTAQLQCHVMGNPLPSIQWERDGQRILGIDERISLMENGTLQITALQETDSGAYTCVASSLSGETSWSGVLTVKESGGLSASPVSEPYQLPGPPQKPVVTDVTRNSVTLTWQPNAHEGGAAVTSYIIEAFSQSAGSTWQTVADFVKLEKHTATGLSPNTIYLFIVRAVNAYGLSDPSPISEPVRTQDVSPTGQGVDHRQVQRELGEMSVQLHEPVLLTASSVKISWNVDRQSQYIQGYRLLYRPVGGSWSQQEVKGATERSAVIANLLKGTEYEIKIRPYFNEFQGLDSRSQTLRTPEEVPSAPPRAVNVATVKLSNSSSISVSWQPPPTDMQNGVIQEYKVWCLGNDSQTRYNINQTVDGSVLSTVLKGLLPGVLYQVEVAAVTSAGVGKHSQPVSVLIKLPAEQPTVTGGGSESEENVSLAEQITDVVKQPAFIAGIGGACWVILMGFSVWIYCRRKKRKELSHYTASFAYTPAVGFPHGESSGLNGRPG lig1b_danre Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1-B lingo1b si:ch211-116a8.1 zgc:92338 lingo1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MTFLQVTIKMVAREASGHSYLVACWQPILILMLGTVLSGSATGCPSRCECSAQERSVVCHRRKLITLPEGIPIDTRLLDLSKNRLKAINPEEFLNYPQLEDLQLNENIISVIEPGAFSNLLGLRTLGLRNNNLKLIQLGVFTGLSNLTRLDISENKIVILLDYMFQELYNLKELEVGDNDLVFISHRAFHGLSSLEQLTMERCNLTSVPTEAFSHLHNLLTLKLRHLNVNVIRDFSFRRLYRLKILEIANWPLLESLTAKSLHGLNITTLSITNCNLTAVPYVAIQHLVYLRFFNLSFNPIEVVEGNKMHNLLRLQAFHLVGGRLVSIEPYSFKGLNYLRVLNVSSNSLSTLEESAFHSVGNLETLALHDNPLACDCRLLWVFRRRWRLNFNRQQPSCETPEFLQGKEFKDFPDVLPPNYFTCQKSKIRDHKAIHRFVDEGTTVQFPCQADGDPTPMIMWQSPKKQFITTKSIGRLSVSLDGTLEVRYAQIQDNGTYTCFAVNAGGNDTRLAHLHVHSYSPNWPHQPNKTFAFILNQPSDNSANGTGAMDPFPFDMKTLIIATTMGFISFLGVVLFCLVLLFLWSRGKGNAKPNIEIEYVPRKVDGENSPNEGSHKISMKMI a8bb44_danre sc:d0342 lingo1a protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MVAGEVSGHSFLVACWQPILILMLGTVLSGSATGCPSRCECNVQERSVLCHRKKLMSVPEGIPSETRLLDLSKNRIKTINPDEFSAFPQLEELELNENTISAIEPGAFNNLYGLQTLGLRSNKLKLIQLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLRSLEVGDNDLVFISHRAFHGLSSLEQLTLEKCNLTSVPTEAFTHLHSLVTLRLRNLNINSIRDYSFKRLYRLKVLEIANWPYLDTMTTNCLYGLNLTSLTITNANLTSIPYLALRHLVYLRFLNMSYNPIQMIEGNRLHDLLRLQELYLVGGRLSVIEPYSFRGLNYLKVLNVSSNFLTTLEESVFHSVGNLETLALHDNPLACDCRLLWVFRRRWRLNFNRQQPTCSSPEFVQGKEFKDFPDILQPNYFTCRKSRIRDRKPQQKFVDEGTTVHFVCQADGDPTPVIMWLSPQKQFITMKTIGRLTVFPDGTLEVRYAQIQDNGTYGCIASNAGGNDTALAHLHVHSYSPDWPNQPNKTLAFISNQPNDNSINETRATVPFPFDIKT a8bbb4_danre lrrc4.1 si:ch211-235l7.2 lrrc4a protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MCHIMSLLGRVAVRRARKAALLCVLFLMVQACVEVVAAAGPQGCPTDCSCNNQLSKVVCTRRGLTRVPPGIPSTTRHLNLMENAIESVQVDSFRNLHHLEVLQLGRNAIRQIEVGAFSGLTNLNTLELFDNRLTVVPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELRKLEYISDGAFEGLVNLKYLNLGMCNIRGEMPNFTPLVGLEELEISENLFPEIKPGSFRGLSSLKKLWIMNSQIGLIERNAFDDLASLVELNLAHNNLSSLPHDLYTPLKYLVELHLHHNPWNCACDSLWLARWLREYIPTNSTCCGRCHSPAHMRGRQLVELDRGDTGAMQCSAPFIADAPRDLNISAERVAELKCRTAAMSAVRWLLPNGTILTHASSHPRLTVLNDGTLNFSNVLAGDTGMYTCMVSNAAGNSNASAYLNVSAAELNTSNLSYFTTVTVEVLSPTSEMPKPKTTTTTAGASTTTTASPSVFQPVFISTPTVLLQSTDTPPSRPSVIPGSKVTTGKPPNPASTSLDEVMKTT a8bb30_danre lrrc24 si:ch211-215e19.1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MDPGQMSAVLVLMLAQLSSTSLACPSGCRCYSLTVECGSIGIKEIPQGITQGTQTIFLQDNAIGQIRQRDLSDLGQLHYLYLQNNSISTLEPGAFRSLGLLLELALNGNRIHLITADVFRGLDHLRILYLAGNQINRLEDYTFRGLQRLQELHLQENVLEVLGDQALVGLSSLALLDLSRNNLRTLSPASLKPLVSLQVLRVTDNPWRCDCALHWLRGWINEEGQRLLSSAERRMLCAEPPRLSHLSLVEVPPNSLVCIPPVVQLEPSHLTVRLGESLRVSCQASGYPQPQVTWRKASHGKAQLSPRGLVQEVGMDGDTRNGGRLVTARPGGKGGPSSHGPIRGGADDGADRENFDPDTGSGMLFLSNVTVAHAGRYECEAWNPGGVARVTFHLSVNMSSSSSRSEIWPRLHSSSYYHPSSVDVSQEPLYELESMDFNALGTAT a4jyh1_danre robo2 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MGPLTHLLLCGLVYFNQVAGSRLRQEDSPPRIVEHPSDLIVSKGEPATLNCKAEGRPTPTVEWYKDGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGAYVCVARNYLGEAVSRNASLEVALLRDDFRQNPTDVVVAAGEPAILECVPPRGHPEPTIYWKKDKVRIDEKDDRIKIRGGKLMISNTRKSDAGMYICVGTNMVGERDSETAQVTVFERPTFLRRPINQVVLEEEAVEFRCQVQGDPQPSIRWKKDDVEIPRGRYDMKFDKDDFTLRIKKATASDEGTFTCVAENRVGKMEASATLTVRAAPQFVIRPRDQIVAQGRTASFPCETKGNPQPAVFWQKEGSQNLLFPNQPQQPNSRFSVSPSGDLTITAVQRADAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPIIRQGPANQTLGVDSVALLRCHASGEPVPTISWLKDGVSLLGKDPRMSLQDLGSLQIKGLRLSDSGIYTCVAASSSGETSWSAFLEVKEAGSLVVVKDRDENELPGPPSKPQVTDVTKNSVSLSWQPGLPGASAISTYVIEAFSQSVSNSWQTVADHVKTTQYTIKGLRPNTIYLFMVRAVNVQGLSDPSPMSEPVRTQDISPPAQGVDHRHVQKELGEVIVRLHNPVVLSPTTIQVTWTVDRQSQFIQGYRVLYRQMSGLSSPGAWQTQDVKVPSERSMVLSALKKGIVYEIKVRPYFNEFQGMDSESRTARTTEEAPSAPPQQVTVLTVGNQNSTSISISWDPPPAEHQNGIIQEYKIWCLGNETRFHVNKTVDAAIRSVVVGGLQAGVQYRVEVAASTSAGVGVKSEPQTIIIGKDFRDVMISRNNSTTEQITDVVKQP a8bax6_danre rtn4rl1b rtn4rl1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MFKRGCGLEFLLVLCGLELSWSCPRHCICYMAPSTVSCQAHNFLSVPEGIPPHSERIFLQNNKIHRLLQGHFSPTTVTLWIYSNNITYIEPSTFQGFTLLEELDLGDNRYLRSLSAETFHGLGRLHALHLYRCGLSALPNNIFQGLRNLQYLYLQDNHLEYLQDDLFVDLHNLSHLFLHGNRLWSLHQNTFRGLGALDRLLLHHNQLQWVDRLAFHDLRRLTTLYLFNNSLTELAGECLTQLPALEYLRLNDNPWECDCKALSLWDWLKKFRGSTSSVGCVAPAELAGKDLKQLRKEDFPNCSGSESLHQSKTNTWAGTNKVSLKQEPHPAQPPQTHPHHPQLNEQFPSPPSPLPQPPPAINGVQVVPGVSPDMIPDQRPGRSRNCTRQRVRGSKGKGPNEVHILKEMADKEYSSPDFTGKYDETSSNGSNTRRKHKCTPRTSVRPP a4jyg3_danre mag protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MKGLELLLLPLLLLLKDASAQWNVWMPRDISAMTNSCVVIPCSFTYPSGIRPYRGVHGIWYFGHPYPQLFPPVVLKSRTDIVHESYKGRTKLLGDLTQKNCTLLISNIGVEHSGKYYFRADLGGANIYTFPDFTKLQVLDQPNIDVPEEIVSDQSLDLTCYVPDNCPDMSPEIHWMYTDYLPDPVFTPDQVEEGNTAVLSSTLTFTPKPMHNGQLLGCRVNFPNTTYVYERLITLDIRYAPRTVWVNVSQEVMEGSSVVLHCDVDSNPAPMITWYFGDKELMSETASNSSLSLENLTPEQEGVYTCVGDNGYGNMNTSMYLAVNYPPREPWINESLTVLEGSSVSLQCTSKGNPMPTLTWLKDGELVGTITAEEGSVLELHEIMPQADGVYRCLAENEHGRASSSLNITVEFAPVLLDDSKCTIVREGVQCVCIASGNPEPAIEFYLPDLNVTINNSNNRFNYYTHSDGYTSTGVIKLQDKGERGNNGDTAVHVHCSITNIYGSETIRLELQQEKK a4jyd8_danre Receptor protein-tyrosine kinase fgfr4 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MLSILKVFIAICFMELVCSRSITSGEPRAKDIRVSRHILTPGYPENATVLVGGHVKLVCKLHQPASTRLQWFKKDSNRLGPDGSPVLTALTPLLENLSKVNIFPLVNISLEDAGEYVCKAENSAGQATRSAWVEVLSEVSEEPTEEPSEHLLLELGDVLKLRCDTNRPGAVQWFKSGVRVQHNARIQIRAAVMEIADVTYEDSGVYVCMLRGTKEALRNFTITVADAVGSGDDDDEDNGLDDIGPETENDQVYISRAPYWTHTQRMEKKLYAVPAGNTVKFRCPATGSPLPTIRWLKNGREFRGEHRIGGIKLRHQHWSLVMESVVPSDRGNYSCVVENKYGSIAHTYLLDVLERSPHRPILQAGLPKNTTAIVGGDAQFLCKVYSDAQPHIQWLKHIEMNGSRYGPDGIPYVKIVKTGSLNMSEVEVLYLTNISMEDAGEYTCLAGNSIGFSHQSAWLTVLSEEDVAKEVDLMEAKYTDIIIYASGFLALVMAIVIVVLCRMQVHPSREPFDTLPVQKLS fgfr4_danre Fibroblast growth factor receptor 4 fgfr4 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MLSILKVFIAICFMELVCSRSITSGEPRAKDIRVSRHILTPGYPENATVLVGGHVKLVCKLHQPASTRLQWFKKDSNRLGPDGSPVLTALTPLLENLSKVNIFPLVNISLEDAGEYVCKAENSAGQATRSAWVEVLSEVSEEPTEEPSEHLLLELGDVLKLRCDTNRPGAVQWFKSGVRVQHNARIQIRAAVMEIADVTYEDSGVYVCMLRGTKEALRNFTITVADAVGSGDDDDEDNGLDDIGPETENDQVYISRAPYWTHTQRMEKKLYAVPAGNTVKFRCPATGSPLPTIRWLKNGREFRGEHRIGGIKLRHQHWSLVMESVVPSDRGNYSCVVENKYGSIAHTYLLDVLERSPHRPILQAGLPKNTTAIVGGDAQFLCKVYSDAQPHIQWLKHIEMNGSRYGPDGIPYVKIVKTGSLNMSEVEVLYLTNISMEDAGEYSCLAGNSIGFSHQSAWLTVLSEEDVAKEVDLMEAKYTDIIIYASGFLALVMAIVIVVLCRMQVHPSREPFDTLPVQKLSKFPLRRQYSVESNSSGKSSASLMRVARLSSSCSPMLAGVMEFELPYDPDWEFPRENLTLGKPLGEGCFGQVVRAEAYGINKENQDHMATVAVKMLKDDATDKDLADLISEMELMKVMDKHKNIINLLGVCTQDGPLYVLVEYASKGSLREYLRARRPPGMDYTFDVTKVPEEQLTFKDLVSCAYQVARGMEYLASKRCIHRDLAARNVLVTEDNVMKIADFGLARGVHQIDYYKKTTNGRMPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPSNCTHELYMKMRECWHAVPTQRPTFKQLVEELDRVLVSISDEYLDLSTPFEQYSPSCEDTSSSCSSDNDSVFTHDALSTEPCLLGYHDVHSRMDLKTTMR a9jrh0_danre lrrn1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MARGTFFLVVEGQICFILLLAVLGLSSVHSTECPQLCVCEIRPWFTPQSTYREATTVDCNDLHLTRIPGNLSADTQVLLLQSNYIARTSEELEQLLNLTELDLSQNNFSNIRDIGLTNMSQLTTLHLEENQIVEMPDFSLQDLTNLQELYINHNQISSIAPNAFAGLRNLLRLHLNSNRLKAIDSRWFESTPNLEILMIGENPVVGILDLNFKPLTNLRSLVLAGMELTDIPGNAFVGLDNLESLSFYDNKLVRVPQTALQKLPNLKFLDLNKNPIHKIQEGDFKNMLRLKELGINNMGELVSIDRFALDNLPELTKLEATNNPKFSYVSRLAFRDLPALESLMLNNNALNSLYQATADSLPNLREISIHSNPLRCDCVIQWMSSNKTTIRFMEPLSMFCTMPIEVRGQRVRDVFSREPSGQCLPMISHDTFPNHLNLDIGMTVDLDCRAMAEPEPEIYWVTPSGNKVMMDTVSDKYQLNSAGTLRISYIQVDDSGHYTCVAQNTEGADTRVTAIRVNGTLLDSTQLMKIYVKHTESHSILVSWKVNSNVMTSNLKWSSATMKIDNPHITYTAKVPVDVHEYNLTHLQPATEYEVCLSVSNIHQQTQKSCVNVTTKHATFAVEISEQGTNTALAAVMGTILAIISLGSITLYIAKRWKRKNYHHSLKKYMQKTSSIPLNELYPPLINLWEADSEKDKDGSSDNKQTQVDTTRSYYMW q503g2_danre vasna vasn protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MPRGLPSTGKQLYVFQNKINILQQQDFVELGELEMLDLSQNSLSEIPDGVFSPLSSLHNLDLSSNYITHISKDSFIGLVNLERLYLYSNIIQNIHPAAFEGLENLLELKLQGNQISVLPALQLPRLLHLDLSYNSIPPLVAQDLQTPHLESLKIAGLGLTSLDEELLGSLINLHVLDVSQNQLVDIQPTLKSMGGLRNLNLTGNPLGSLKHEDFQNLVNLLELDLSNLNLQGFPEGFFNLFPKLEKLTAAENPFNCLCPLAWFPAWLKDVRVELLRTEETRCHFPPINSGKVLEKLEHKDFGCPTTTIELTSAGTSSTTSKPTNSSTQSGTTHIVPPAPLSDISSADADNFPVYQTTAFPSRIMEDSEGEGIMCPPNICLNGGTCIFKSNGVIVCLCPPSMSGLYCEIQNEAMLPPPSPRVSLETIATVQPNTISSHHITSTSISLDLHRYIQTRPHIRGIRLTYSNLSGPDRRPLQLSVPPSYPEYTLRGLQPNSTYSVCASPLGEPVHASVSACMEARTAGIPPSSHEPSVDRTEPSSSLTPIVVAVAVVMVVAIIATVVVISRRRRPKAPVDMDLHETSPLEMEGVKTNPENGLTHPKQPDITPCPSLAPNSLEYDVLLIQGQGQCPANNNIDCTKALYV q5bl20_danre islr2 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MATKYLMLIALGTALIGNAHCCPKQCACSDKYNHQFVDCAYKDLVEVPVGLPSNASTLSLSANKIKVLKSKTFVNVTQVTSLWLAHNEIITVERDTLAPLIQLKNLDISNNKIVHFPWEDLANLGALQLLKMNNNEMVSIPKNAFSNLKDLRSIRINNNKFTTIVQGTFDSLAAMSHLQIFHNPFICSCNLEWLRDWILKSSISIPEQNNIACDAPSHLKGSQVTSMPKLNCKAPSVSITYQPNIEKTELYEGYMVMLYCETKGTPKPEVTWEIFAGNQLITFPLPAIVEKSDIPINGPPTNTRFLVFQNGTLIVPRMSKKEEGNYTCSAVNDIGKAESSVRLVVAGTKKHATNSMLDTKSPGLLPEDKLGSKGSKNSVISMRPKFEEKTKSLPTGTSVITVDKEQVDEGADTLPFVGKCGINDGTQYISNHAFNLSLDELKQYTFDFGVIALEVSETEAKVQLNPMQMANAKSNIHLSQQQDLQTVNKEPFSLFQTSAKKSPLDLLYLCVSTGNGHSVVQWSKIEEGVNAYRFQHLKPGTNYTLCLTYGGQDCQVQVVFTTRKKIPSLLIIVVVSIFLLALATVPLLGATCCHLLYKYQGKTYKLIMKTQNPDQMEKNIATDFDPRASFVGSEKNFNPSEMGEGEGEADGEEGDGEGEDIEGSVVTESIPESQSKTQEEFEVGSEYSDRLPLGAEAVNISAEINGNYKQPR q90z70_danre robo2 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MGPLTHLLLCGLVYFNQVDGSRLRQEDSPPRIVEHPSDLIVSKGEPATLNCKAEGRPTPTVEWYKDGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGAYVCVARNYLGEAVSRNASLEVALLRDDFRQNPTDVVVAAGEPAILECVPPRGHPEPTIYWKKDKVRIDEKDDRIKIRGGKLMISNTRKSDAGMYICVGTNMVGERDSETAQVTVFERPTFLRRPTNQVVLEEEAVEFRCQVQGDPQPSIRWKKDDVEIPRGRYDMKFDKDDFTLRIKKATASDEGTFTCVAENRVGKMEASATLTVRARPVAAPQFVIRPRDQIVAQGRTASFPCETKGNPQPAVFWQKEGSQNLLFPNQPQQPNSRFSVSPSGDLTITAVQRADAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPIIRQGPANQTLGVDSVALLRCHASGEPVPTISWLKDGVSLLGKDPRMSLQDLGSLQIKGLRLSDSGIYTCVAASSSGETSWSAFLEVKEAGSLVVVKDRDENELPGPPSKPQVTDVTKNSVSLSWQPGLPGASAISTYVIEAFSQSVSNSWQTVADHVKTTQYTIKGLRPNTIYLFMVRAVNVQGLSDPSPMSEPVRTQDISPPAQGGDHRHVQKELGEVIVRLHNPVVLSPTTIQVTWTVDRQSQFIQGYRVLYRQMSGLSSPGAWQTQDVKVPSERSMVLSALKKGIVYEIKVRPYFNEFQGMDSESRTARTTEEAPSAPPQQVTVLTVGNQNSTSISISWDPPPAEHQNGIIQEYKIWCLGNETRFHVNKTVDAAIRSVVVGGLQAGVQYRVEVAASTSAGVGVKSEPQTIIIGKDFRDVMISRNNSITEQITDVVKQPAFIAGIGGACWVILMGFSIWLYWRRKKRKGLSNYAVQSFTFTPAVTFQRVDGGLMSNGSRPGLLNASDSGYPWLADSWPPSLPVNSGSGGPNDLSFGRGDVMPSAQADKTGTMLSDGAIYSSIDFTTKGGFGSPSPASQATPYATTQILHSNSIHELAVDLPEAQWKTSLQAKQEMASLGYSLPDKNSCNNTLLFIPDYRLADGLSNRMPHNQSQDFSTTSSHNSSDRSNSLSGGKGGKKKKTKANVKPTKMNGSNWANVPLPPPPIHPLPGTEMDHYASEHHDGGGYDSDGWGPPLPVQTYLHQGLEDELEEEEERVPTPPIRGVASSPAAVSFGKQSTATLSPSPREEMQPMLQAHLDELTRAYQLDMAKQTWHMQGGPYPPQAPAPPVGYISSTLVSDIETDLPDEDDDDEEDEGYEMSPPIRGTEHTPGSSMDNLDSSVTDKGLPHRPRPASPFSTDGSTVGTHSLGHQRAARPTRKHKGPGTVPNRRDASADDLPPPPEPPPCQTARIPGSRNVPHPCDRKASSLERQPMMGLEEMRSSLDRQARTSLDRHQQVQDRLGSIERGDESRRGQKNGPFSEEALLPYNKPSFPSPGGHSSSGTASSKGSTGPRKGEGTRGQHQRSTTEQGESSYMGTNAQFSGEL b8jkm0_danre lrrtm1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MLMDFLLIGLYLKWPLRKPPGLILCSLGIVLKIVPLVGGSCPRLCRCDNKQLYCEGLNLTDIPQNLSSAIGLSLRENNISELREGNFVGLSQLTWLYLDHNNIEIVEESAFERLRRIKELDLSTNRIESLPNGTFRPLPNLRILDLSYNRLQSLEPDLFHGLRKLTNLHLRYNALKFIPVRIFQDCRSMQFLDLGYNQLQSLARNSFAGLFKLTELHLEHNELVKVNLAHFPRLISLRTLYMRNNKATIVVNTLEWTWDYLEKIDFSNNEIEYIEPHVFESVPKLNTLMLDSNKLTYIDQRILDSWTSLSSITLSGNDWECSRNVCALASWLSNFQGQRDSGLLCANPDIAQGEDILDAVYAFQLCEDNVEATTQTFTVTRNRPRGFIYEGPTKNPYDLQDMEGGEVVTNSLTVTASADDLESTMKIHKVVTGTMALIFSFLIMVLMLYVSWKCFPAGVRQLRQCFTSQRRKQKQKQTMQQMATTSASEYYVDYKPNHIDGGLVIINEYGSCKCQQQASRECEV a9jr35_danre Netrin receptor UNC5 unc5b protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MLSTCIHRDQSPASLLGLLLLSSTLVIHADGSDYSEVLPDSFPSAPAEPLPEFQSEPEDAFIVKNRPVKLSCKAAPATQIYFKCNGEWVNQNDHVTKESLDHITGLVVREVDISVSRTQVEELFGLEDYWCQCVAWSSAGTTKSRRAYVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPEGSPPAEVDWLKNEELIDPALDSNFLITIEHDLIIKQARLSDTANYTCVARNVVAKRRSSTATLIVYVSGGWSSWTEWSECNAQCGRGWQRRTRSCTNPAPLNGGAFCDGPPFQRVTCTTLCPVDGGWTEWAKWSACGTECTHWRSRECQAPPPRNGGRHCSGSMMESKNCTEGLCARNKKVSVEHTSHPLGSGTGVAVYAGLVGALLLCVILVLCVGILVYRRSCRHLHGEITDSSSALTAAFHPGNYKPPRQDNPHLLHPTAPPDLTASAGTFRGPLFSLQQATLDSHHKIPMTTSPLLDPLPSLKIKVYNSSTMSSLELPTGLGSVDGEIMSLKTVGSGPKDHHGHTLPREPSHSASATLGSLGGRLTIPNTGVGLLVPPGTIPQGKFYEMYLIINKWEKTTLPSDGSQTVLSPVVSCGPSGMLLSRPVVLTLPHCAQLEPPDWTLTLKMQNHQGAWEEVLTVGEESLSSPCYLQVEEQSCHILMEQLGTYGLVGQSAPPRPACKRLQLALFAPRAPCLSLDYSLRVYCIQDTPHALKEVLEVERSLGGVLLEDPKPLLFKDSYHNLRLSIHDIPHSHWRSKLLAKYQEIPFYHIWSGSQRPLHCTFSLERGSLVVSQLTCKICVRQVEGEGQIFQLNTDIQETLPPHSPLPAGGSCLPSSQVGPYAFRLPVSIRQKICASLDAPSARGCDWRMLARSLAFDRYLNYFATKPSPTGVLLDLWEACHQGDADLVSLATALEEMGKSEVLVVMTTDGDC q6wzd2_danre rtn4rl1b ngrh2a rtn4rl1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MFKRGCGLEFLLVLCGLELSWSCPRHCICYMAPSTVSCQAHNFLSVPEGIPPHSERIFLQNNKIHRLLQGHFSPTTVTLWIYSNNITYIEPSTFQGFTLLEELDLGDNRYLRSLSAETFHGLGRLHALHLYRCGLSALPNNIFQGLRNLQYLYLQDNHLEYLQDDLFVDLHNLSHLFLHGNRLWSLHQNTFRGLGALDRLLLHHNQLQWVDRLAFHDLRRLTTLYLFNNSLTELAGECLTQLPALEYLRLNDNPWECDCKALSLWDWLKKFRGSTSSVGCVAPAELAGKDLKQLRKEDFPNCSGSESLHQSKTNTWAGTNKVSLKQEPHPAQPPQTHPHHPQLNEQFPSPPSPLPQPPPAINGVQVVPGVSPDMIPDQRPGRSRNCTRQRVRGSKGKGPNEVHILKEMADKEYSSPDFTGKYDETSSNGSNTRRKHKCTPRTSVRPPSGVQQATNLGHSHHTHLFLCSISGLLTLILR q5w433_danre siglec-4 mag protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MKGLELLLLPLLLLLKDASAQWNVWMPRDISAMTNSCVVIPCSFTYPSGIRPYRGVHGIWYFGHPYPQLFPPVVLKSRTDIVHESYKGRTKLLGDLTQKNCTLLISNIGVEHSGKYYFRADLGGANIYTFPDFTKLQVLDQPNIDVPEEIVSDQSLDLTCYVPDNCPDMSPEIHWMYTDYLPDPVFTPDQVEEGNTAVLSSTLTFTPKPMHNGQLLGCRVNFPNTTYVYERLITLDIRYAPRTVWVNVSQEVMEGSSVVLHCDVDSNPAPMITWYFGDKELMSETASNSSLSLENLTPEQEGVYTCVGDNGYGNMNTSMYLAVNYPPREPWINESLTVLEGSSVSLQCTSKGNPMPTLTWLKDGELVGTITAEEGSVLELHEIMPQADGVYRCLAENDYGASSSLNITVEFAPVLLDDSKCTIVREGVQCVCIASGNPEPAIEFYLPDHVTINNSNNRFNYYTHSDGYTSTGVIKLQDKGERGNNGDTAVHVHCSITNIYGSETIRLELQQEKKYMMAVIVGTIGGVAVIAFIIAAVRYVGQNNKKENGNPGQDVGSKVENPSMFYSAVKKDKQSLRKKVLKTELLGSKFNSILEEGTGDDSDYQSVGPMAGMERQELNYAALEFLHGRHREGVFRRADGDGSDYTEIKAK lrrtm2-lrrtm2 796103 n/a 796106 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796106 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. A author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High A High lrrtm1-lrrtm1 796103 n/a 796107 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796107 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. A author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High A High flrt1a-flrt1a 796103 n/a 796108 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796108 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. A author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High A High lrrtm3a-lrrtm3a 796103 n/a 796109 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796109 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. A author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High A High lrrtm3b-lrrtm3b 796103 n/a 796110 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796110 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. A author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High A High nlrr1-ngl1 796103 n/a 796111 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 796112 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. C author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High C High unc5b-flrt1b 796103 n/a 796113 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 796114 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. C author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High C High unc5b-flrt1a 796103 n/a 796108 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796113 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. C author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High C High islr2-slitlike2 796103 n/a 796115 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 796116 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. C author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High C High lrrtm2-lrrtm1 796103 n/a 796106 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796107 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. C author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High C High lrrtm1-lrrtm3a 796103 n/a 796107 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796109 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. C author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High C High lrrtm1-lrrtm3b 796103 n/a 796107 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796110 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. C author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High C High unc5b-flrt3 796103 n/a 796117 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 796113 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. D author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High D High unc5b-islr2 796103 n/a 796113 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 796116 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. D author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High D High lrrtm1-fgfrl1b 796103 n/a 796107 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796118 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. D author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High D High lrrtm3a-lrrtm3b 796103 n/a 796110 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796109 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. D author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High D High elfn2-igsf21 796103 n/a 796119 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796120 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High E High lrrtm1-boc 796103 n/a 796107 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796121 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High E High lrrtm1-fgfrl1a 796103 n/a 796107 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796122 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High E High ngl1-nlrr1 796103 n/a 796111 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796112 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. C author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High C High flrt1b-unc5b 796103 n/a 796114 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796113 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. C author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High C High flrt1a-unc5b 796103 n/a 796108 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796113 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. C author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High C High slitlike2-islr2 796103 n/a 796123 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 796116 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. C author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High C High lrrtm1-lrrtm2 796103 n/a 796106 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. n/a 796107 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. C author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High C High lrrtm3a-lrrtm1 796103 n/a 796107 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796109 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. C author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High C High lrrtm3b-lrrtm1 796103 n/a 796107 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796110 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. C author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High C High flrt3-unc5b 796103 n/a 796117 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796113 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. D author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High D High islr2-unc5b 796103 n/a 796113 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 796116 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. D author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High D High fgfrl1b-lrrtm1 796103 n/a 796107 unspecified role unspecified role prey prey betalactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796124 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. D author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High D High lrrtm3b-lrrtm3a 796103 n/a 796110 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796109 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. D author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High D High igsf21-elfn2 796103 n/a 796119 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796120 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High E High boc-lrrtm1 796103 n/a 796107 unspecified role unspecified role prey prey beta lactamase binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796121 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High E High fgfrl1a-lrrtm1 796103 n/a 796122 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796107 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. E author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High E High robo3-elfn1 796103 n/a 796125 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796126 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. F author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High F High boc-lrrtm3a 796103 n/a 796121 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796109 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. F author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High F High elfn1-robo3 796103 n/a 796127 unspecified role unspecified role prey prey n/a 796126 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. F author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High F High lrrtm3a-boc 796103 n/a 796121 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 796109 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. F author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. High F High lingo1a-lingo1b 796103 n/a 796128 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 796129 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. G author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Low G Low nlrr1-ngl2 796103 n/a 796112 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human n/a 796130 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. G author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Low G Low lrrtm2-lrrtm3b 796103 n/a 796106 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796110 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. G author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Low G Low lrrc24-robo2 796103 n/a 796131 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796132 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. G author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Low G Low lrrtm1-rtn4rl1 796103 n/a 796107 unspecified role unspecified role bait bait region l-glutamyl-5-poly(adp-ribose) L-glutamyl-5-poly(ADP-ribose) L-glutamyl-5-poly(ADP-ribose) L-isoglutamyl-poly(ADP-ribose) MOD_RES PolyADP-ribosyl glutamic acid (S)-2-amino-5-poly[2'-adenosine 5'-(trihydrogen diphosphate) 5'->5'-ester with 1alpha-D-ribofuranosyl]oxy-5-oxopentanoic acid ADP Ribose addition ADP-Ribosyl O-ADP-ribosylation (on Glutamate or C terminus) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796133 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. H author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Low H Low lrrtm3a-lrrc24 796103 n/a 796131 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796109 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. H author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Low H Low flrt3-mag 796103 n/a 796117 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796134 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. H author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Low H Low elfn2-boc 796103 n/a 796119 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796121 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Low I Low flrt3-boc 796103 n/a 796117 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796121 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Low I Low lrrtm1-fgfr4 796103 n/a 796107 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796135 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. J author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Low J Low robo2-lrrtm1 796103 n/a 796132 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796107 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. K author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Low K Low lrrtm2-lrrtm3a 796103 n/a 796106 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796109 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. K author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Low K Low lrrtm1-mag 796103 n/a 796107 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796134 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. L author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Low L Low rtn4rl1-lrrtm1 796103 n/a 796133 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796107 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. H author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Low H Low lrrc24-lrrtm3a 796103 n/a 796131 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796109 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. H author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Low H Low mag-flrt3 796103 n/a 796134 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796117 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. H author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Low H Low fgfr4-lrrtm1 796103 n/a 796107 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796136 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. J author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Low J Low lrrtm1-robo2 796103 n/a 796107 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796132 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. K author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Low K Low lrrtm3a-lrrtm2 796103 n/a 796106 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796109 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. K author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Low K Low mag-lrrtm1 796103 n/a 796134 unspecified role unspecified role bait bait region l-glutamyl-5-poly(adp-ribose) L-glutamyl-5-poly(ADP-ribose) L-glutamyl-5-poly(ADP-ribose) L-isoglutamyl-poly(ADP-ribose) MOD_RES PolyADP-ribosyl glutamic acid (S)-2-amino-5-poly[2'-adenosine 5'-(trihydrogen diphosphate) 5'->5'-ester with 1alpha-D-ribofuranosyl]oxy-5-oxopentanoic acid ADP Ribose addition ADP-Ribosyl O-ADP-ribosylation (on Glutamate or C terminus) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 796107 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. L author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Low L Low lrrc4a-lrrn1 796104 n/a 796137 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 796130 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region bound to beads with tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false additional data file 2 islr2-vasn 796104 n/a 796138 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 796139 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false additional data file 2 lrrtm1-robo2-1 796104 n/a 796140 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 796141 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false additional data file 2 flrt1b-unc5b-1 796104 n/a 796114 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 796142 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false additional data file 2 rtn4rl1-lrrtm1-1 796104 n/a 796141 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 796143 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false additional data file 2 fgfrl1a-lrrtm1-1 796104 n/a 796141 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 796122 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false additional data file 2 lrrtm2-lrrtm1-1 796104 n/a 796106 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 796141 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false additional data file 2 lrrtm4l1-lrrtm1 796104 n/a 796141 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 796109 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false additional data file 2 flrt3-mag-1 796104 n/a 796117 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 796144 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false additional data file 2 unc5b-flrt1a-1 796105 n/a 796108 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 796142 unspecified role unspecified role prey prey direct interaction direct interaction false false false 3 K off is 7.2 micromoles/second. unc5b-flrt1b-1 796105 n/a 796114 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 796142 unspecified role unspecified role prey prey direct interaction direct interaction false false false 3 K off is 0.6 micro moles per second. unc5b-flrt3-1 796105 n/a 796142 unspecified role unspecified role prey prey n/a 796117 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 3 K off is 5.5 micro moles per second.