MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint sutter-2009-1 A distinct structural region of the prokaryotic ubiquitin-like protein (Pup) is recognized by the N-terminal domain of the proteasomal ATPase Mpa. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Sutter M., Striebel F., Damberger FF., Allain FH., Weber-Ban E. FEBS Lett. (0014-5793) 2009 Only protein-protein interactions imex curation sutter-2009-2 A distinct structural region of the prokaryotic ubiquitin-like protein (Pup) is recognized by the N-terminal domain of the proteasomal ATPase Mpa. in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Sutter M., Striebel F., Damberger FF., Allain FH., Weber-Ban E. FEBS Lett. (0014-5793) 2009 Only protein-protein interactions imex curation arc_myctu Proteasome-associated ATPase AAA ATPase forming ring-shaped complexes Mycobacterial proteasome ATPase MTCY261.11c Rv2115c mpa protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MGESERSEAFGIPRDSPLSSGDAAELEQLRREAAVLREQLENAVGSHAPTRSARDIHQLEARIDSLAARNSKLMETLKEARQQLLALREEVDRLGQPPSGYGVLLATHDDDTVDVFTSGRKMRLTCSPNIDAASLKKGQTVRLNEALTVVEAGTFEAVGEISTLREILADGHRALVVGHADEERVVWLADPLIAEDLPDGLPEALNDDTRPRKLRPGDSLLVDTKAGYAFERIPKAEVEDLVLEEVPDVSYADIGGLSRQIEQIRDAVELPFLHKELYREYSLRPPKGVLLYGPPGCGKTLIAKAVANSLAKKMAEVRGDDAHEAKSYFLNIKGPELLNKFVGETERHIRLIFQRAREKASEGTPVIVFFDEMDSIFRTRGTGVSSDVETTVVPQLLSEIDGVEGLENVIVIGASNREDMIDPAILRPGRLDVKIKIERPDAEAAQDIYSKYLTEFLPVHADDLAEFDGDRSACIKAMIEKVVDRMYAEIDDNRFLEVTYANGDKEVMYFKDFNSGAMIQNVVDRAKKNAIKSVLETGQPGLRIQHLLDSIVDEFAENEDLPNTTNPDDWARISGKKGERIVYIRTLVTGKSSSASRAIDTESNLGQYL This sequence has been withdrawn from Uniprot. 4D5F4E630614C58D mint pup_myctu Prokaryotic ubiquitin-like protein Pup Rv2111c Bacterial ubiquitin-like modifier pup protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MAQEQTKRGGGGGDDDDIAGSTAAGQERREKLTEETDDLLDEIDDVLEENAEDFVRAYVQKGGQ 7D958B770D8766E3 mint pup-mpa 855105 q0g9y7_myctu mpa 855107 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false b6dac1_myctu pup 855108 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false F5 mint mpa-pup 855106 q0g9y7_myctu mpa 855107 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false b6dac1_myctu pup 855108 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false F6 mint