IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ yao-2009-4 A synaptic vesicle-associated Ca2+ channel promotes endocytosis and couples exocytosis to endocytosis. in vitro In vitro crosslink cross-linking study crosslink anti tag western anti tag western blot anti tag western Yao CK., Lin YQ., Ly CV., Ohyama T., Haueter CM., Moiseenkova-Bell VY., Wensel TG., Bellen HJ. Interaction observed using different cross-linking agents Bis(Sulfosuccinimidyl) suberate (BS3), disuccinimidyl suberate (DSS), 1,5-Difluoro-2,4-dinitrobenzene (DFDNB), or Dithiobis(succinimidyl propionate) (DSP). hbellen@bcm.tmc.edu Cell (0092-8674) 2009 Only protein-protein interactions 12 imex curation yao-2009-2 A synaptic vesicle-associated Ca2+ channel promotes endocytosis and couples exocytosis to endocytosis. drome-head Drosophila melanogaster head anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yao CK., Lin YQ., Ly CV., Ohyama T., Haueter CM., Moiseenkova-Bell VY., Wensel TG., Bellen HJ. Existence of higher molecular weight homo-oligomers were identified by the molecular weight of anti-tag blots. hbellen@bcm.tmc.edu Cell (0092-8674) 2009 Only protein-protein interactions 12 imex curation yao-2009-3 A synaptic vesicle-associated Ca2+ channel promotes endocytosis and couples exocytosis to endocytosis. in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel anti tag western anti tag western blot anti tag western Yao CK., Lin YQ., Ly CV., Ohyama T., Haueter CM., Moiseenkova-Bell VY., Wensel TG., Bellen HJ. Homo-multimers were formed both in detergent-solubilized phospholipid liposomes hbellen@bcm.tmc.edu Cell (0092-8674) 2009 Only protein-protein interactions 12 imex curation yao-2009-1 A synaptic vesicle-associated Ca2+ channel promotes endocytosis and couples exocytosis to endocytosis. drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yao CK., Lin YQ., Ly CV., Ohyama T., Haueter CM., Moiseenkova-Bell VY., Wensel TG., Bellen HJ. hbellen@bcm.tmc.edu Cell (0092-8674) 2009 Only protein-protein interactions 12 imex curation flowr_drome Calcium channel flower fwe CG6151 flower protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSFAEKITGLLARPNQQDPIGPEQPWYLKYGSRLLGIVAAFFAILFGLWNVFSIITLSVSCLVAGILQMVAGFVVMLLEAPCCFVCFGQVNEIAEKVESKPLYFRAGLYIAMAIPPIILCFGLASLFGSGLIFGTGVVYGMMALGKKASAEDMRAAAQQTFGGNTPAQTNDRAGIVNNAQPFSFTGAVGTDSNV q95t12-2 Calcium channel flower fwe CG6151 flower protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSFAEKITGLLARPNQQDPIGPEQPWYLKYGSRLLGIVAAFFAILFGLWNVFSIITLSVSCLVAGILQMVAGFVVMLLEAPCCFVCFGQVNEIAEKVESKPLYFRAGLYIAMAIPPIILCFGLASLFGSGLIFGTGVVYGMMALGKKASREDMAAAATSPTQMAGSQAGGQMQMGGDQHITLMEDPDVWRPT flower-9 Homodimerisation of flower-1 864732 n/a 864736 unspecified role unspecified role neutral component neutral component c-terminal 1D4 tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast Stoichiometry: 2.0 direct interaction direct interaction false false false Fig. 7B Homodimers, homotrimers, homotetramers and higher order multimers were observed. flower-10 Homodimerisation of flower-1 864732 n/a 864736 unspecified role unspecified role neutral component neutral component c-terminal 1D4 tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast Stoichiometry: 2.0 direct interaction direct interaction false false false Supp. Fig. 6 Homodimers, homotrimers, homotetramers and higher order multimers were observed. flower-11 Homotrimerisation of flower-1 864732 n/a 864736 unspecified role unspecified role neutral component neutral component c-terminal 1D4 tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast Stoichiometry: 3.0 direct interaction direct interaction false false false Supp. Fig. 6 Homodimers, homotrimers, homotetramers and higher order multimers were observed. flower-12 Homotetramerisation of flower-1 864732 n/a 864736 unspecified role unspecified role neutral component neutral component c-terminal 1D4 tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast Stoichiometry: 4.0 direct interaction direct interaction false false false Supp. Fig. 6 Homodimers, homotrimers, homotetramers and higher order multimers were observed. flower-3 Homodimerisation of flower-1 864733 n/a 864737 unspecified role unspecified role neutral component neutral component n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 physical association physical association false false false Fig. 5C Homodimers, homotrimers, homotetramers and higher order multimers were observed. flower-4 Homotrimerisation of flower-1 864733 n/a 864737 unspecified role unspecified role neutral component neutral component n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 3.0 physical association physical association false false false Fig. 5C Homodimers, homotrimers, homotetramers and higher order multimers were observed. flower-5 Homotetramerisation of flower-1 864733 n/a 864737 unspecified role unspecified role neutral component neutral component n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 4.0 physical association physical association false false false Fig. 5C Homodimers, homotrimers, homotetramers and higher order multimers were observed. flower-6 Homodimerisation of flower-1 864734 n/a 864736 unspecified role unspecified role neutral component neutral component c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast Stoichiometry: 2.0 physical association physical association false false false Fig. 7B, Supp Fig. 6 Homodimers, homotrimers, homotetramers and higher order multimers were observed. flower-7 Homotrimerisation of flower-1 864734 n/a 864736 unspecified role unspecified role neutral component neutral component c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast Stoichiometry: 3.0 physical association physical association false false false Fig. 7B, Supp. Fig. 6 Homodimers, homotrimers, homotetramers and higher order multimers were observed. flower-8 Homotetramerisation of flower-1 864734 n/a 864736 unspecified role unspecified role neutral component neutral component c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast Stoichiometry: 4.0 physical association physical association false false false Fig. 7B, Supp. Fig. 6 Homodimers, homotrimers, homotetramers and higher order multimers were observed. flower-1 Self assocation of flower-1 864735 n/a 864737 unspecified role unspecified role prey prey n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 864737 unspecified role unspecified role bait bait n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5B flower-2 Self assocation of flower-1 864735 n/a 864737 unspecified role unspecified role prey prey n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 864737 unspecified role unspecified role bait bait n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5B