MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint nie-2009-2 The Y-box factor ZONAB/DbpA associates with GEF-H1/Lfc and mediates Rho-stimulated transcription. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Nie M., Aijaz S., Leefa Chong San IV., Balda MS., Matter K. EMBO Rep. (1469-221X) 2009 Only protein-protein interactions imex curation nie-2009-1 The Y-box factor ZONAB/DbpA associates with GEF-H1/Lfc and mediates Rho-stimulated transcription. canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Nie M., Aijaz S., Leefa Chong San IV., Balda MS., Matter K. EMBO Rep. (1469-221X) 2009 Only protein-protein interactions imex curation nie-2009-3 The Y-box factor ZONAB/DbpA associates with GEF-H1/Lfc and mediates Rho-stimulated transcription. canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Nie M., Aijaz S., Leefa Chong San IV., Balda MS., Matter K. EMBO Rep. (1469-221X) 2009 Only protein-protein interactions imex curation q9n1q2_canlf ZONAB protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MSEAGEATGTTSSSSSSLPQAPAEAAPAAPQDPAPKSPGGSGAPQAAAPPPAALAAGNPGGDAAPAATGTAAPASSAPAGGEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHHTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRRRYRRGYYGRRRGPPRNYAGEEEEEGSGSSEGFDPPATDGQFSGARSQLRRPQYRPQYRRRFPPYHVGQTFDRRSRVFPHPNRMQAGEIGEMKEGVPEGTQLQGPVHRNPTYRPRYRRGPPRPRPAPAVGEAEDKENQQAANGPNQPSARRGYRRPYNYRRRPRPPNAPSQDGKETKAPEVPSENPAPATEQSSAE mint arhg2_canlf Rho guanine nucleotide exchange factor 2 ARHGEF2 Guanine nucleotide exchange factor H1 Tight junction-associated guanine nucleotide exchange factor isoform A protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MSRIESLTRARTERSRELASKNREKEKMKEAKDARYTNGHLFTTISVSGMTMCYACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLKNSTALQSVSLRSKTTPRERPSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFSDESPLGLRRILSQSTDSLNMRNRALSVESLIDEGAEVIYSELMSDFETDERDFAADSWSLAVDSSFLQQQKKEVMKQQDVIYELIQTELHHVRTLKIMTRLFRTGMLEELQLEPGVVQGLFPCVDELSDIHTRFLSQLLERRRQALCPGSTRNFVIHRLADLLISQFSGPSAERMRKAYSEFCSRHTKALKLYKELYARDKRFQQFIRKVTRSAVLKRHGVQECILLVTQRITKYPVLINRILQHSHGTDEERQDLTTALGLVKELLSNVDQDVHELEKGARLQEIYHRMDPRAQAPVPSKGPFGREELLRRKLIHDGCLLWKTATGRFKDVLMLLMTDVLVFLQEKDQKYIFPALDKPSVVSLQNLIVRDIANQEKGMFLISAAPPEMYEVHTASRDDRSTWVRVIQQSVRVCPSREDFPLIETEDEAYLRRIKMELQQKDKALVELLREKVGLFAEMTHFQVEEDSGGVALPALPRGLFRSESLECPRGERLLQDAIREVEGLKDLLVGPGVELLLTPRDPALLVDPDSGGSTSPGVTANGEARNFNGSIELCRTDSDSSQKDRNGNQLRAPQEEALQRLVNLYGLLHGLQAAVAQQDTLMEARFPEGPERREKLARANSRDGEAGRVGPAPVAPDKQATELALLQRQHALLQEELRRCRRLGEERATEAGNLEARLRESEQARALLEREAEEARRQLAILGQSEPPPAEAPWARRPLDPRRRSLPAGDALYLSFTPPQPSRGHDRLDLSVTIRSVHRPFEDRERQELGSPEERLQDSSDPDTGSEEEGGGRLSPPHSPRDFTRMQDIPEETESRDGEPMVSES mint q9n1q3_canlf ZONAB protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MSEAGEATGTTSSSSSSLPQAPAEAAPAAPQDPAPKSPGGSGAPQAAAPPPAALAAGNPGGDAAPAATGTAAPASSAPAGGEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHHTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRRRYRRGYYGRRRGPPRNAGEIGEMKEGVPEGTQLQGPVHRNPTYRPRYRRGPPRPRPAPAVGEAEDKENQQAANGPNQPSARRGYRRPYNYRRRPRPPNAPSQDGKETKAPEVPSENPAPATEQSSAE mint mark/par1 Mark/Par1 protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris mint zo1_canlf Tight junction protein ZO-1 TJP1 ZO1 Zonula occludens protein 1 Zona occludens protein 1 Tight junction protein 1 protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MSARAAAAKNTAMEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAEGQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKKVQIPVSRPDPEPVSENEDSYDEEVHDPRSSRGGLVSRRSEKSWARDRSASRERSLSPRSDRRSVASSQPPKPTKVTLVKSRKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTVTENMSLTDAKTLIERSKGKLKMVVQRDERATLLNVPDLSDSIHSANASERDDISEIQSLASDHSGRSHDRPPRHSRSRSPDQRSEPSDHSRHSPQQPSSGSLRSREEERISKPGAVSTPVKHADDHTHKTVEEVVVERNEKQAPSLPEPKPVYAQVGQPDVDLPVSPSDGVLPNSTHEDGILRPSMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIREEAVLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKGEVFRVVDTLYNGKLGSWLAIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRADFWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADVAREKLAREEPDIYQIAKSEPRDAGTDQRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRLNYAQWYPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVREDSSGMHHENQTYPPYSPQAQPQPIHRIDSPGFKTASQQKAEASSPVPYLSPETNPASSTSAVNHNVTLTNVRLEGPTPAPSTSYSPQADSLRTPSTEAAHIMLRDQEPSLPSHVEPAKVYRKDPYPEEMMRQNHVLKQPAVGHPGQRPDKEPNLSYESQPPYVEKQANRDLEQPTYRYDSSSYTDQFSRNYDHRLRYEERIPTYEEQWSYYDDKQPYQPRPSLDNQHPRDLDSRQHPEESSERGSYPRFEEPAPLSYDSRPRYDQPPRTSTLRHEEQPTPGYDMHNRYRPEAQSYSSAGPKASEPKQYFDQYPRSYEQVPSQGFSSKAGHYEPLHGAAVVPPLIPASQHKPEVLPSNTKPLPPPPTLTEEEEDPAMKPQSVLTRVKMFENKRSASLENKKDENHTAGFKPPEVASKPPGAPIIGPKPTPQNQFSEHDKTLYRIPEPQKPQMKPPEDIVRSNHYDPEEDEEYYRKQLSYFDRRSFENKPSTHIPAGHLSEPAKPVHSQNQTNFSSYSSKGKSPEADAPDRSFGEKRYEPVQATPPPPPLPSQYAQPSQPGTSSSLALHTHAKGAHGEGNSISLDFQNSLVSKPDPPPSQNKPATFRPPNREDTVQSTFYPQKSFPDKAPVNGAEQTQKTVTPAYNRFTPKPYTSSARPFERKFESPKFNHNLLPSETAHKPDLSSKAPASPKTLAKAHSRAQPPEFDSGVETFSIHADKPKYQMNNLSTVPKAIPVSPSAVEEDEDEDGHTVVATARGVFNNNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCASMTPDGWSFALKSSDSSSGDPKTWQNKCLPGDPNYLVGANCVSVLIDHF mint The N-terminal may be involved in transducing a signal required for tight junction assembly, while the C-terminal may have specific properties of tight junctions. The alpha domain might be involved in stabilizing junctions arhgef2-zonab-1 859413 q9n1q2_canfa ZONAB 859416 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level q865s3_canfa GEF-H1 859417 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain false physical association physical association false false false f2d mint arhgef2-zonab-2 859413 q865s3_canfa GEF-H1 859417 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain false gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q9n1q2_canfa ZONAB-B 859416 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2e mint arhgef2-zonab-3 859413 q9n1q3_canfa ZONAB-A 859418 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q865s3_canfa GEF-H1 859417 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain false gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2e mint arhgef2-zonab-4 859413 q865s3_canfa GEF-H1 859417 predetermined predetermined participant predetermined unspecified role unspecified role bait bait partially purified partially purified binding site binding region binding-associated region binding region n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain false gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q9n1q2_canfa ZONAB-B 859416 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2f mint arhgef2-mark_par1 859413 mark/par1 MARK 859419 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level q865s3_canfa GEF-H1 859417 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain false intervening domain physical association physical association false false false mint sf4c arhgef2-mark_par1-1 859413 q865s3_canfa GEF-H1 859417 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain false gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false mark/par1 MARK 859419 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mint sf4d sf4e arhgef2-zonab 859414 q865s3_canfa GEF-H1 859417 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level q9n1q2_canfa ZONAB 859416 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f2a mint zonab-arhgef2 859414 q865s3_canfa GEF-H1 859417 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level q9n1q2_canfa ZONAB 859416 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f2a f2b mint arhgef2-mark_par1-2 859415 q865s3_canfa GEF-H1 859417 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false mark/par1 MARK 859419 monoclonal immunost monoclonal antibody immunostaining monoclonal immunost unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f3c mint arhgef2-tjp1 859415 zo1_canfa ZO-1 859420 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell q865s3_canfa GEF-H1 859417 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false mint sf2 sf3 sf8b