IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ dobney-2009-6 The calmodulin-related calcium sensor CML42 plays a role in trichome branching. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Dobney S., Chiasson D., Lam P., Smith SP., Snedden WA. wayne.snedden@queensu.ca J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation dobney-2009-1 The calmodulin-related calcium sensor CML42 plays a role in trichome branching. in vitro In vitro cd circular dichroism CD CD cd predetermined predetermined participant predetermined Dobney S., Chiasson D., Lam P., Smith SP., Snedden WA. wayne.snedden@queensu.ca J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation dobney-2009-2 The calmodulin-related calcium sensor CML42 plays a role in trichome branching. in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Dobney S., Chiasson D., Lam P., Smith SP., Snedden WA. wayne.snedden@queensu.ca J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation dobney-2009-3 The calmodulin-related calcium sensor CML42 plays a role in trichome branching. in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr tag fluorescence tag visualisation by fluorescence tag fluorescence Dobney S., Chiasson D., Lam P., Smith SP., Snedden WA. ANS (8-Anilino-1-napthalenesulphonate) fluorescence emission spectra (400 to 600 nm) were used to monitor the exposed hydrophobic surfaces of CML42. wayne.snedden@queensu.ca J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation dobney-2009-4 The calmodulin-related calcium sensor CML42 plays a role in trichome branching. in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Dobney S., Chiasson D., Lam P., Smith SP., Snedden WA. wayne.snedden@queensu.ca J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation dobney-2009-5 The calmodulin-related calcium sensor CML42 plays a role in trichome branching. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Dobney S., Chiasson D., Lam P., Smith SP., Snedden WA. wayne.snedden@queensu.ca Clontech Matchmaker Yeast Two Hybrid System J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation dobney-2009-7 The calmodulin-related calcium sensor CML42 plays a role in trichome branching. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Dobney S., Chiasson D., Lam P., Smith SP., Snedden WA. wayne.snedden@queensu.ca J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation cml42_arath Calcium-binding protein CML42 CML42 Calmodulin-like protein 42 F21C20.130 At4g20780 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MESNNNEKKKVARQSSSFRLRSPSLNALRLQRIFDLFDKNGDGFITVEELSQALTRLGLNADLSDLKSTVESYIQPGNTGLNFDDFSSLHKTLDDSFFGGACGGGENEDDPSSAAENESDLAEAFKVFDENGDGFISARELQTVLKKLGLPEGGEMERVEKMIVSVDRNQDGRVDFFEFKNMMRTVVIPSS kic_arath Calcium-binding protein KIC KIC At2g46600 KCBP-interacting calcium-binding protein F13A10.13 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEPTEKSMLLETTSTTKMETKYEDMLPVMAEKMDVEEFVSELCKGFSLLADPERHLITAESLRRNSGILGIEGMSKEDAQGMVREGDLDGDGALNQTEFCVLMVRLSPEMMEDAETWLEKALTQELCNHNLSSMP calcium(2+) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) cml42-kic-1 854607 n/a 854614 unspecified role unspecified role bait bait n/a 854615 unspecified role unspecified role prey prey physical association physical association false false false Figure 6 cml42-kic-2 854607 n/a 854615 unspecified role unspecified role bait bait n/a 854614 unspecified role unspecified role prey prey physical association physical association false false false Figure 6 cml42-ca 854608 n/a 854614 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 854616 unspecified role unspecified role neutral component neutral component direct interaction direct interaction false false false Figure 2 cml42-ca-1 854609 n/a 854616 unspecified role unspecified role neutral component neutral component n/a 854614 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 3 cml42-ca-2 854610 n/a 854614 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 854616 unspecified role unspecified role neutral component neutral component direct interaction direct interaction false false false Figure 4 cml42-ca-3 854611 n/a 854616 unspecified role unspecified role neutral component neutral component n/a 854614 unspecified role unspecified role neutral component neutral component n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 5 Table 1 Magnesium ions Mg2+ 0.34+/- 0.02 Kd without 5mM magnesium ions 07.14 +/- 0.66 Kd with 5mM magnesium ions -7.31+/- 0.04 Delta H without 5mM magnesium ions -6.49 +/- 0.15 with 5mM magnesium ions cml42-kic 854612 n/a 854615 unspecified role unspecified role prey prey n/a 854614 unspecified role unspecified role bait bait physical association physical association false false false cml42-kic-3 854613 n/a 854615 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 854614 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 7 Interaction observed only in the presence of Ca++ ions.