IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ yang-2009b-3 Arabidopsis 14-3-3 lambda is a positive regulator of RPW8-mediated disease resistance. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Yang X., Wang W., Coleman M., Orgil U., Feng J., Ma X., Ferl R., Turner JG., Xiao S. xiao@umbi.umd.edu An Arabidopsis cDNA library constructed using mRNA extracted from leaf tissues challenged with several pathogens , details of pathogens not supplied by authors. Plant J. (0960-7412) 2009 Only protein-protein interactions imex curation yang-2009b-1 Arabidopsis 14-3-3 lambda is a positive regulator of RPW8-mediated disease resistance. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Yang X., Wang W., Coleman M., Orgil U., Feng J., Ma X., Ferl R., Turner JG., Xiao S. xiao@umbi.umd.edu An Arabidopsis cDNA library constructed using mRNA extracted from leaf tissues challenged with several pathogens , details of pathogens not supplied by authors. Plant J. (0960-7412) 2009 Only protein-protein interactions imex curation yang-2009b-2 Arabidopsis 14-3-3 lambda is a positive regulator of RPW8-mediated disease resistance. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Yang X., Wang W., Coleman M., Orgil U., Feng J., Ma X., Ferl R., Turner JG., Xiao S. xiao@umbi.umd.edu An Arabidopsis cDNA library constructed using mRNA extracted from leaf tissues challenged with several pathogens , details of pathogens not supplied by authors. Plant J. (0960-7412) 2009 Only protein-protein interactions imex curation rpw82_arath Protein RESISTANCE TO POWDERY MILDEW 8.2 RPW8.2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MIAEVAAGGALGLALSVLHEAVKRAKDRSVTTRFILHRLEATIDSITPLVVQIDKFSEEMEDSTSRKVNKRLKLLLENAVSLVEENAELRRRNVRKKFRYMRDIKEFEAKLRWVVDVDVQVNQLADIKELKAKMSEISTKLDKIMPQPKFEIHIGWCSGKTNRAIRFTFCSDDS 14336_arath 14-3-3-like protein GF14 lambda General regulatory factor 6 14-3-3-like protein RCI2 14-3-3-like protein AFT1 GRF6 AFT1 RCI2 F12B17_200 At5g10450 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAATLGRDQYVYMAKLAEQAERYEEMVQFMEQLVTGATPAEELTVEERNLLSVAYKNVIGSLRAAWRIVSSIEQKEESRKNDEHVSLVKDYRSKVESELSSVCSGILKLLDSHLIPSAGASESKVFYLKMKGDYHRYMAEFKSGDERKTAAEDTMLAYKAAQDIAAADMAPTHPIRLGLALNFSVFYYEILNSSDKACNMAKQAFEEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQEQMDEA rpw8_2-14_3_3-2 855244 n/a 855247 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 855248 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false Figure 1d rpw8_2-14_3_3-3 855244 n/a 855247 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 855248 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false Figure 1e rpw8_2-14_3_3 855245 n/a 855247 unspecified role unspecified role bait bait n/a 855248 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 1a rpw8_2-14_3_3-1 855246 n/a 855247 unspecified role unspecified role bait bait c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 855248 unspecified role unspecified role prey prey physical association physical association false false false Figure 1c