IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ santiago-2009-1 Modulation of drought resistance by the abscisic acid-receptor PYL5 through inhibition of clade A PP2Cs. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Santiago J., Rodrigues A., Saez A., Rubio S., Antoni R., Dupeux F., Park SY., Marquez JA., Cutler SR., Rodriguez PL. prodiguez@ibmcp.upv.es Plant J. (0960-7412) 2009 Only protein-protein interactions imex curation santiago-2009-2 Modulation of drought resistance by the abscisic acid-receptor PYL5 through inhibition of clade A PP2Cs. nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Santiago J., Rodrigues A., Saez A., Rubio S., Antoni R., Dupeux F., Park SY., Marquez JA., Cutler SR., Rodriguez PL. prodiguez@ibmcp.upv.es Plant J. (0960-7412) 2009 Only protein-protein interactions imex curation santiago-2009-3 Modulation of drought resistance by the abscisic acid-receptor PYL5 through inhibition of clade A PP2Cs. nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Santiago J., Rodrigues A., Saez A., Rubio S., Antoni R., Dupeux F., Park SY., Marquez JA., Cutler SR., Rodriguez PL. prodiguez@ibmcp.upv.es Plant J. (0960-7412) 2009 Only protein-protein interactions imex curation santiago-2009-4 Modulation of drought resistance by the abscisic acid-receptor PYL5 through inhibition of clade A PP2Cs. in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Santiago J., Rodrigues A., Saez A., Rubio S., Antoni R., Dupeux F., Park SY., Marquez JA., Cutler SR., Rodriguez PL. prodiguez@ibmcp.upv.es Plant J. (0960-7412) 2009 Only protein-protein interactions imex curation p2c16_arath Protein phosphatase 2C 16 HAB1 P2C-HA Protein phosphatase 2C HAB1 AtP2C-HA Protein HYPERSENSITIVE TO ABA 1 F28P22.4 At1g72770 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEMTPAVAMTLSLAANTMCESSPVEITQLKNVTDAADLLSDSENQSFCNGGTECTMEDVSELEEVGEQDLLKTLSDTRSGSSNVFDEDDVLSVVEDNSAVISEGLLVVDAGSELSLSNTAMEIDNGRVLATAIIVGESSIEQVPTAEVLIAGVNQDTNTSEVVIRLPDENSNHLVKGRSVYELDCIPLWGTVSIQGNRSEMEDAFAVSPHFLKLPIKMLMGDHEGMSPSLTHLTGHFFGVYDGHGGHKVADYCRDRLHFALAEEIERIKDELCKRNTGEGRQVQWDKVFTSCFLTVDGEIEGKIGRAVVGSSDKVLEAVASETVGSTAVVALVCSSHIVVSNCGDSRAVLFRGKEAMPLSVDHKPDREDEYARIENAGGKVIQWQGARVFGVLAMSRSIGDRYLKPYVIPEPEVTFMPRSREDECLILASDGLWDVMNNQEVCEIARRRILMWHKKNGAPPLAERGKGIDPACQAAADYLSMLALQKGSKDNISIIVIDLKAQRKFKTRT pyl8_arath Abscisic acid receptor PYL8 PYL8 ABIP1 RCAR3 PYR1-like protein 8 ABI1-binding protein 1 Regulatory components of ABA receptor 3 MFH8.10 At5g53160 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEANGIENLTNPNQEREFIRRHHKHELVDNQCSSTLVKHINAPVHIVWSLVRRFDQPQKYKPFISRCVVKGNMEIGTVREVDVKSGLPATRSTERLELLDDNEHILSIRIVGGDHRLKNYSSIISLHPETIEGRIGTLVIESFVVDVPEGNTKDETCYFVEALIKCNLKSLADISERLAVQDTTESRV pyl6_arath Abscisic acid receptor PYL6 T3G21 At2g40330 PYL6 ABIP5 RCAR9 PYR1-like protein 6 ABI1-binding protein 5 Regulatory components of ABA receptor 9 T7M7.15 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPTSIQFQRSSTAAEAANATVRNYPHHHQKQVQKVSLTRGMADVPEHVELSHTHVVGPSQCFSVVVQDVEAPVSTVWSILSRFEHPQAYKHFVKSCHVVIGDGREVGSVREVRVVSGLPAAFSLERLEIMDDDRHVISFSVVGGDHRLMNYKSVTTVHESEEDSDGKKRTRVVESYVVDVPAGNDKEETCSFADTIVRCNLQSLAKLAENTSKFS pyl5_arath Abscisic acid receptor PYL5 At5g05440 PYL5 ABIP3 RCAR8 PYR1-like protein 5 ABI1-binding protein 3 Regulatory components of ABA receptor 8 K18I23.25 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRSPVQLQHGSDATNGFHTLQPHDQTDGPIKRVCLTRGMHVPEHVAMHHTHDVGPDQCCSSVVQMIHAPPESVWALVRRFDNPKVYKNFIRQCRIVQGDGLHVGDLREVMVVSGLPAVSSTERLEILDEERHVISFSVVGGDHRLKNYRSVTTLHASDDEGTVVVESYIVDVPPGNTEEETLSFVDTIVRCNLQSLARSTNRQ pyl4_arath Abscisic acid receptor PYL4 At2g38310 PYL4 ABIP2 RCAR10 PYR1-like protein 4 ABI1-binding protein 2 Regulatory components of ABA receptor 10 T19C21.20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MLAVHRPSSAVSDGDSVQIPMMIASFQKRFPSLSRDSTAARFHTHEVGPNQCCSAVIQEISAPISTVWSVVRRFDNPQAYKHFLKSCSVIGGDGDNVGSLRQVHVVSGLPAASSTERLDILDDERHVISFSVVGGDHRLSNYRSVTTLHPSPISGTVVVESYVVDVPPGNTKEETCDFVDVIVRCNLQSLAKIAENTAAESKKKMSL pyr1_arath Abscisic acid receptor PYR1 PYR1 ABIP6 At4g17870 RCAR11 Protein PYRABACTIN RESISTANCE 1 ABI1-binding protein 6 Regulatory components of ABA receptor 11 T6K21.50 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPSELTPEERSELKNSIAEFHTYQLDPGSCSSLHAQRIHAPPELVWSIVRRFDKPQTYKHFIKSCSVEQNFEMRVGCTRDVIVISGLPANTSTERLDILDDERRVTGFSIIGGEHRLTNYKSVTTVHRFEKENRIWTVVLESYVVDMPEGNSEDDTRMFADTVVKLNLQKLATVAEAMARNSGDGSGSQVT abscisic acid abscisic acid small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) abscisic acid (CHEBI:22152) is a apo carotenoid sesquiterpenoids (CHEBI:36758) , abscisic acid (CHEBI:22152) is a monocarboxylic acids (CHEBI:25384) IUPAC name (2Z,4E)-5-(1-hydroxy-2,6,6-trimethyl-4-oxocyclohex-2-en-1-yl)-3-methylpenta-2,4-dienoic acid hab1-pyl8 853322 n/a 853326 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9CAJ0:p.Gly246Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false n/a 853327 unspecified role unspecified role prey prey physical association physical association false false false Figure 1 hab1-pyl6 853322 n/a 853328 unspecified role unspecified role prey prey n/a 853326 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9CAJ0:p.Gly246Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 1 hab1-pyl5 853322 n/a 853326 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9CAJ0:p.Gly246Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false n/a 853329 unspecified role unspecified role prey prey physical association physical association false false false Figure 1 hab1-pyl6-1 853322 n/a 853326 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 853328 unspecified role unspecified role bait bait physical association physical association false false false Figure 1 hab1-pyl8-1 853322 n/a 853327 unspecified role unspecified role bait bait n/a 853326 unspecified role unspecified role prey prey Q9CAJ0:p.Gly246Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 1 hab1-pyl5-1 853322 n/a 853326 unspecified role unspecified role prey prey Q9CAJ0:p.Gly246Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false n/a 853329 unspecified role unspecified role bait bait physical association physical association false false false Figure 1 hab1-pyl4 853322 n/a 853326 unspecified role unspecified role prey prey Q9CAJ0:p.Gly246Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false n/a 853330 unspecified role unspecified role bait bait physical association physical association false false false Figure 1 The interaction only occurred in the presence of 10 micro molar abscisic acid hab1-pyr1 853322 n/a 853331 unspecified role unspecified role bait bait n/a 853326 unspecified role unspecified role prey prey Q9CAJ0:p.Gly246Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 1 The interaction only occurred in the presence of 10 micro molar abscisic acid hab1-pyl5-2 853323 n/a 853326 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9CAJ0:p.Gly246Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false region N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 853329 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 3d hab1-pyl5-3 853324 n/a 853326 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 853329 unspecified role unspecified role prey prey region C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 3e pyl5-aba 853325 n/a 853332 unspecified role unspecified role prey prey n/a 853329 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 7 Dissociation constant 1.1 micro molar , enthalpy value -7.9Kcal -1 mol, entropy value 1.3 cal mol-1 K-1 addition of protein Q9CAJ0 C-terminal domain (amino acid region 179 to 511).