MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint grimm-2009-2 Molecular recognition of histone lysine methylation by the Polycomb group repressor dSfmbt. in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Grimm C., Matos R., Ly-Hartig N., Steuerwald U., Lindner D., Rybin V., Müller J., Müller CW. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation grimm-2009-3 Molecular recognition of histone lysine methylation by the Polycomb group repressor dSfmbt. spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection pull down pull down predetermined predetermined participant predetermined Grimm C., Matos R., Ly-Hartig N., Steuerwald U., Lindner D., Rybin V., Müller J., Müller CW. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation grimm-2009-1 Molecular recognition of histone lysine methylation by the Polycomb group repressor dSfmbt. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Grimm C., Matos R., Ly-Hartig N., Steuerwald U., Lindner D., Rybin V., Müller J., Müller CW. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation smbt_drome Polycomb protein Sfmbt Scm-like with four MBT domain-containing protein 1 CG16975 Sfmbt dSfmbt protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNPSELRMMWMSSQYNSERITLEDAATLLGHPTVGLSVMEDLSAHQPTLDMNPMMSLMGGDFTGQAAATAAALGVQPGTLIATNSNNLYGFAHMGGLQQQLLQQSAAAAVFQNYAEAMDNDVENGMVGMAMEAVVDDDDQVYGQRDNNFDDNGSELEPKQEIINIDDFVMMNEDNNSYDGTDFMTSSDKDISQSSSSCMAQMPGSLGVPGVEHDLLVPLPDGLLHHKLLGTTLVPAMGTLNGNAFGNIMVSTENTSSKQMQRTYSTAKGANSTATTATCSASTSSALRSQRKTRKIEPVNRPGLVLKTPIAYRGNIDPSVIPIQKDGMAVCKRCGAIGVKHTFYTKSRRFCSMACARGELYSLVLNTKMEGDQATTSSPDPGAGSESADLPGDQQQSQSDIELDLHAAHIKNANYRFRITDQSKITQLNSFGEPMSMGGDAAANNVQMAADETIAALNGGAVGDATAPGSTEEGASTPNSYLSAAPTPKALRLFKDIYPQDDLPQIPKYERLPVPCPQMEKIISIRRRMYDPTHSYDWLPRLSKENFNAAPVTCFPHAPGCEVWDNLGVGMKVEVENTDCDSIEVIQPGQTPTSFWVATILEIKGYKALMSYEGFDTDSHDFWVNLCNAEVHSVGWCATRGKPLIPPRTIEHKYKDWKDFLVGRLSGARTLPSNFYNKINDSLQSRFRLGLNLECVDKDRISQVRLATVTKIVGKRLFLRYFDSDDGFWCHEDSPIIHPVGWATTVGHNLAAPQDYLERMLAGREAMIEVHEDDATIELFKMNFTFDEYYSDGKTNSFVEGMKLEAVDPLNLSSICPATVMAVLKFGYMMIRIDSYQPDASGSDWFCYHEKSPCIFPAGFCSVNNISVTPPNGYDSRTFTWEGYLRDTGAVAAGQHLFHRIIPDHGFEVGMSLECADLMDPRLVCVATVARVVGRLLKVHFDGWTDEYDQWLDCESADIYPVGWCVLVNHKLEGPPRVAHQQAPKPAPKPKIQRKRKPKKGAAGGKTPTDNNTQSVKSRTIALKTTPHLPKLSIKLELKPEHHNAAFYENNQPEEEGDEEDPDADGDGDGSTSHISEQSTTQSSSDLIAGSGSGSGSASLVTLATGSNKTNSSATNNKYIPRLADIDSSEPHLELVPDTWNVYDVSQFLRVNDCTAHCDTFSRNKIDGKRLLQLTKDDIMPLLGMKVGPALKISDLIAQLKCKVNPGRARSHKTNKSPFL h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG h33_human Histone H3.3 H3-3A H3-3B H3.3A H3.3B H3F3 H3F3A H3F3B PP781 protein protein human Homo sapiens Human MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA scm_drome Polycomb protein Scm Scm CG9495 Sex comb on midleg protein protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSGGRDSSTSSGSNSAAPGASTNATSSASASASSTSTSASPGSTTSPASTQRQRGRPAKRATCTWCGEGKLPLQYVLPTQTGKKEFCSETCIAEFRKAYSKGACTQCDNVIRDGAPNKEFCSIMCMNKHQKKNCSTRHSGGSASGKGLAESERKLLASGAPAPTGPFQYESFHVFDWDAYLEETGSEAAPAKCFKQAQNPPNNDFKIGMKLEALDPRNVTSTCIATVVGVLGSRLRLRLDGSDSQNDFWRLVDSTEIHAIGHCEKNGGMLQPPLGFRMNASSWPGYLCKILNNAMVAPEEIFQPEPPEPEENLFKVGQKLEAVDKKNPQLICCATVDAIKDDQIHVTFDGWRGAFDYWCNYRSRDIFPAGWCARSCHPMQPPGHKSRMDSSSSKQRCPRPRYTVVAESEAMVPASPATAHFHPNCKGGPFINNSKLPCMVTGPTYQTLAKLCLQEVLAASTDTQQLSKLLFALEGDVHIVTAAGKNFTVKIPSPMRMKDDESLAQFIETLCTTCRACANLISLVHETEECKKCANSRKRQLTQSATPPSSPVLADKRNRQSNSATTSPSEKIIKQELAVKSPVESKSKTSTNNGKEPASQQNSNHSLNNNNNSASKSSNKVVIKSEPNGANAQTSSTTQALRKVRFQHHANTNTNSSATNGNQDTSQTTHVSTSHCSSSSTSSSTSLAGGSANTSTIGKYLAPLVAEVHPEQANVKPSNSYYKSPTTLSSSASLPTSVSTPFTGCQSASSTALAAGGVTAAKAATAPAGAAATAGASPSYTAITSPVSTPTSALANSHLRSQPIDWTIEEVIQYIESNDNSLAVHGDLFRKHEIDGKALLLLNSEMMMKYMGLKLGPALKICNLVNKVNGRRNNLAL php_drome Polyhomeotic-proximal chromatin protein CG18412 ph-p protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDRRALKFMQKRADTESDTTTPVSTTASQGISASAILAGGTLPLKDNSNIREKPLHHNYNHNNNNSSQHSHSHQQQQQQQVGGKQLERPLKCLETLAQKAGITFDEKYDVASPPHPGIAQQQATSGTGPATGSGSVTPTSHRHGTPPTGRRQTHTPSTPNRPSAPSTPNTNCNSIARHTSLTLEKAQNPGQQVAATTTVPLQISPEQLQQFYASNPYAIQVKQEFPTHTTSGSGTELKHATNIMEVQQQLQLQQQLSEANGGGAASAGAGGAASPANSQQSQQQQHSTAISTMSPMQLAAATGGVGGDWTQGRTVQLMQPSTSFLYPQMIVSGNLLHPGGLGQQPIQVITAGKPFQGNGPQMLTTTTQNAKQMIGGQAGFAGGNYATCIPTNHNQSPQTVLFSPMNVISPQQQQNLLQSMAAAAQQQQLTQQQQQFNQQQQQQLTQQQQQLTAALAKVGVDAQGKLAQKVVQKVTTTSSAVQAATGPGSTGSTQTQQVQQVQQQQQQTTQTTQQCVQVSQSTLPVGVGGQSVQTAQLLNAGQAQQMQIPWFLQNAAGLQPFGPNQIILRNQPDGTQGMFIQQQPATQTLQTQQNQIIQCNVTQTPTKARTQLDALAPKQQQQQQQVGTTNQTQQQQLAVATAQLQQQQQQLTAAALQRPGAPVMPHNGTQVRPASSVSTQTAQNQSLLKAKMRNKQQPVRPALATLKTEIGQVAGQNKVVGHLTTVQQQQQATNLQQVVNAAGNKMVVMSTTGTPITLQNGQTLHAATAAGVDKQQQQLQLFQKQQILQQQQMLQQQIAAIQMQQQQAAVQAQQQQQQQVSQQQQVNAQQQQAVAQQQQAVAQAQQQQREQQQQVAQAQAQHQQALANATQQILQVAPNQFITSHQQQQQQQLHNQLIQQQLQQQAQAQVQAQVQAQAQQQQQQREQQQNIIQQIVVQQSGATSQQTSQQQQHHQSGQLQLSSVPFSVSSSTTPAGIATSSALQAALSASGAIFQTAKPGTCSSSSPTSSVVTITNQSSTPLVTSSTVASIQQAQTQSAQVHQHQQLISATIAGGTQQQPQGPPSLTPTTNPILAMTSMMNATVGHLSTAPPVTVSVTSTAVTSSPGQLVLLSTASSGGGGSIPATPTKETPSKGPTATLVPIGSPKTPVSGKDTCTTPKSSTPATVSASVEASSSTGEALSNGDASDRSSTPSKGATTPTSKQSNAAVQPPSSTTPNSVSGKEEPKLATCGSLTSATSTSTTTTITNGIGVARTTASTAVSTASTTTTSSGTFITSCTSTTTTTTSSISNGSKDLPKAMIKPNVLTHVIDGFIIQEANEPFPVTRQRYADKDVSDEPPKKKATMQEDIKLSGIASAPGSDMVACEQCGKMEHKAKLKRKRYCSPGCSRQAKNGIGGVGSGETNGLGTGGIVGVDAMALVDRLDEAMAEEKMQTEATPKLSESFPILGASTEVPPMSLPVQAAISAPSPLAMPLGSPLSVALPTLAPLSVVTSGAAPKSSEVNGTDRPPISSWSVDDVSNFIRELPGCQDYVDDFIQQEIDGQALLLLKEKHLVNAMGMKLGPALKIVAKVESIKEVPPPGEAKDPGAQ hist1h4a-sfmbt-1 858294 smbt_drome dSfmbt 858297 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false h4_human HaK20me1 858298 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm direct interaction direct interaction false false false 858294 homomint mint H4 protein\'s taxid has not been specified t2 h3f3a-sfmbt 858294 h33_human H3 858299 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false smbt_drome dSfmbt 858297 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Q9VK33:p.Asp808Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 858294 homomint mint H3 protein\\'s taxid has not been specified t2 h3f3a-sfmbt-1 858294 smbt_drome dSfmbt 858297 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false h33_human H3 858299 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified dimethyllysine n6,n6-dimethyl-lysine n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 858294 homomint mint H3 protein\\'s taxid has not been specified t2 st1 h3f3a-sfmbt-2 858294 h33_human H3 858299 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified dimethyllysine n6,n6-dimethyl-lysine n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false smbt_drome dSfmbt 858297 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 858294 homomint mint t2 st1 H3 protein\\'s taxid has not been specified hist1h4a-sfmbt-2 858294 h4_human HaK20me1 858298 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false smbt_drome dSfmbt 858297 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Q9VK33:p.Asp917Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 858294 homomint mint H4 protein\'s taxid has not been specified t2 sf1a st1 hist1h4a-sfmbt-3 858294 h4_human HaK20me1 858298 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false smbt_drome dSfmbt 858297 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q9VK33:p.Tyr948Phe mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q9VK33:p.Glu947Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 858294 t2 homomint mint H4 protein\'s taxid has not been specified hist1h4a-sfmbt-4 858294 h4_human HaK20me1 858298 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm smbt_drome dSfmbt 858297 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q9VK33:p.Asp697Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 858294 t2 homomint mint H4 protein\'s taxid has not been specified hist1h4a-sfmbt-5 858294 h4_human HaK20me1 858298 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified methyllysine n6-methyl-lysine n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false smbt_drome dSfmbt 858297 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q9VK33:p.Tyr948Phe mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q9VK33:p.Asp917Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q9VK33:p.Glu947Ala mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 858294 homomint mint H4 protein\'s taxid has not been specified t2 hist1h4a-sfmbt-6 858294 h4_human HaK20me1 858298 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm smbt_drome dSfmbt 858297 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Q9VK33:p.Asp808Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 858294 t2 homomint mint H4 protein\'s taxid has not been specified hist1h4a-sfmbt-7 858294 h4_human HaK20me1 858298 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false smbt_drome dSfmbt 858297 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 858294 homomint mint H4 protein\'s taxid has not been specified t2 hist1h4a-sfmbt-8 858294 h4_human HaK20me1 858298 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false smbt_drome dSfmbt 858297 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 858294 homomint mint H4 protein\'s taxid has not been specified t2 hist1h4a-sfmbt-9 858294 smbt_drome dSfmbt 858297 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false h4_human HaK20me1 858298 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm direct interaction direct interaction false false false 858294 homomint mint H4 protein\'s taxid has not been specified t2 h3f3a-sfmbt-3 858294 h33_human H3 858299 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified dimethyllysine n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false smbt_drome dSfmbt 858297 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 858294 homomint mint H3 protein\\'s taxid has not been specified t2 h3f3a-sfmbt-4 858294 h33_human H3 858299 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false smbt_drome dSfmbt 858297 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 858294 homomint mint H3 protein\\'s taxid has not been specified t2 sf1b st1 h3f3a-sfmbt-5 858294 smbt_drome dSfmbt 858297 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false h33_human H3 858299 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 858294 homomint mint H3 protein\\'s taxid has not been specified t2 sf1b st1 h3f3a-sfmbt-6 858294 h33_human H3 858299 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false smbt_drome dSfmbt 858297 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 858294 homomint mint H3 protein\\'s taxid has not been specified t2 h3f3a-sfmbt-7 858294 h33_human H3 858299 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm smbt_drome dSfmbt 858297 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q9VK33:p.Asp917Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 858294 homomint mint H3 protein\\'s taxid has not been specified t2 h3f3a-sfmbt-8 858294 h33_human H3 858299 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false dimethyllysine n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm smbt_drome dSfmbt 858297 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 858294 homomint mint H3 protein\\'s taxid has not been specified t2 sf1b st1 h3f3a-sfmbt-9 858294 smbt_drome dSfmbt 858297 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false h33_human H3 858299 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 858294 homomint mint H3 protein\\'s taxid has not been specified t2 h3f3a-sfmbt-10 858294 smbt_drome dSfmbt 858297 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Q9VK33:p.Asp697Ala mutation decreasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false h33_human H3 858299 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 858294 homomint mint H3 protein\\'s taxid has not been specified t2 h3f3a-sfmbt-11 858294 smbt_drome dSfmbt 858297 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false h33_human H3 858299 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified trimethyllysine n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 858294 homomint mint H3 protein\\'s taxid has not been specified t2 sf1b st1 h3f3a-sfmbt-12 858294 smbt_drome dSfmbt 858297 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false h33_human H3 858299 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 858294 homomint mint H3 protein\\'s taxid has not been specified t2 st1 h3f3a-sfmbt-13 858294 h33_human H3 858299 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false smbt_drome dSfmbt 858297 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 858294 homomint mint H3 protein\\'s taxid has not been specified t2 st1 h3f3a-sfmbt-14 858294 smbt_drome dSfmbt 858297 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false h33_human H3 858299 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false dimethyllysine n6,n6-dimethyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm direct interaction direct interaction false false false 858294 homomint mint t2 st1 H3 protein\\'s taxid has not been specified scm-ph_p-1 858295 scm_drome Scm 858300 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false php_drome ph 858301 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false mint f7a sf3 scm-sfmbt 858295 smbt_drome dSfmbt 858297 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell scm_drome Scm 858300 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false homomint mint f7a sf3 hist1h4a-sfmbt 858296 h4_human HaK20me1 858298 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified methyllysine n6-methyl-lysine n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false smbt_drome dSfmbt 858297 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false homomint mint H4 protein\'s taxid has not been specified t1 f1a f2