MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint lopezpaz-2009-1 Maize AKINbetagamma dimerizes through the KIS/CBM domain and assembles into SnRK1 complexes. in vitro In vitro pull down pull down predetermined predetermined participant predetermined López-Paz C., Vilela B., Riera M., Pagès M., Lumbreras V. FEBS Lett. (0014-5793) 2009 l_pez_paz-2009-1 Maize AKINbetagamma dimerizes through the KIS/CBM domain and assembles into SnRK1 complexes. nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined López-Paz C., Vilela B., Riera M., Pagès M., Lumbreras V. FEBS Lett. (0014-5793) 2009 lopezpaz-2009-2 Maize AKINbetagamma dimerizes through the KIS/CBM domain and assembles into SnRK1 complexes. nicbe Nicotiana benthamiana chromatography chromatography technology column chromatography chromatography predetermined predetermined participant predetermined López-Paz C., Vilela B., Riera M., Pagès M., Lumbreras V. FEBS Lett. (0014-5793) 2009 b4fx20_maize ZEAMMB73_Zm00001d044315 100286384 protein protein maize Zea mays (Maize) Maize MDQPEENPEFPSCDAYFEAIQSKKKLPLTLQESLTAAFAQIPVSSFPEVPAGRVIEIPGDTSVIDAVRTLSEQNIRAAPVLNPEPGAPTDWQGRYLGVIDYSAIILWVLENAELAAVALSAASATAAGVGMGAVGAVGVAALGTTGPAAVAGLTAAAIGASVAGGLTAEKGVAKDGLTAADHLGEDFYKVLLQQEPFRSTTVRSIVESYRWSPFVPITLDTSMLTVLLLLSKYRLRNVPVIEPEKPIIRNFITQTGVVKGLQQCKGRDWFDYISALPLSDLGLPFMSIDEVITVNSDDLILEAFKCMKDNKIGGVPVVEGPKRKLVGSVSIRDIRFLLLRPNLFSNFRQLTVIEFMKTLGSTLPDSESNCLVKPPPTCTPDASLGSVIDSIASRITHRIYVVDDDLEVVGVVTLRDVISCFIHEPPGYCDNYLASAMEKLEGKGVRSVEKI mint q8h1l5_maize Non-specific serine/threonine protein kinase protein protein maize Zea mays (Maize) Maize LNVRWKKNGHYNVKCRWCPGFPEVNDTLDASNSFLGDSTIMDNDDANGRLPTVVKFEFQLYKTKDDKYLLDMQRVTGPQLLFLDFCAAFLTKLRVL mint b4fx20-b4fx20-1 813072 b4fx20_maize AKIN 813075 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false b4fx20_maize AKIN 813075 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false F3A mint b4fx20-b4fx20-2 813072 b4fx20_maize AKIN 813075 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false b4fx20_maize AKIN 813075 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false F3A mint b4fx20-b4fx20-3 813072 b4fx20_maize AKIN 813075 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified b4fx20_maize AKIN 813075 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false F3C mint b4fx20-q8h1l5 813073 q8h1l5_maize SnRK1 813076 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false b4fx20_maize AKIN 813075 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F2B mint b4fx20-b4fx20 813073 b4fx20_maize AKIN 813075 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false b4fx20_maize AKIN 813075 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F5 mint b4fx20-b4fx20-4 813074 b4fx20_maize AKIN 813075 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false b4fx20_maize AKIN 813075 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false F4 mint