IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ li-2009a-2 Nuclear Activity of ROXY1, a Glutaredoxin Interacting with TGA Factors, Is Required for Petal Development in Arabidopsis thaliana. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li S., Lauri A., Ziemann M., Busch A., Bhave M., Zachgo S. Binding strength was assessed by measuring growth of transfromed colonies on selective media containing SD/-Trp-His-Leu-Ade and 3-amino-1,2,4-triazole (3-AT) after incubation in a growth chamber at 28 degrees celcius for 2 to 5 days. zachgo@biologie.uni-osnbrueck.de Arabidopsis whole plant cDNA library Plant Cell (1040-4651) 2009 Only protein-protein interactions imex curation li-2009a-1 Nuclear Activity of ROXY1, a Glutaredoxin Interacting with TGA Factors, Is Required for Petal Development in Arabidopsis thaliana. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Li S., Lauri A., Ziemann M., Busch A., Bhave M., Zachgo S. Binding strength was assessed by measuring growth of transfromed colonies on selective media containing SD/-Trp-His-Leu-Ade and 3-amino-1,2,4-triazole (3-AT) after incubation in a growth chamber at 28 degrees celcius for 2 to 5 days. zachgo@biologie.uni-osnbrueck.de Arabidopsis whole plant cDNA library Plant Cell (1040-4651) 2009 Only protein-protein interactions imex curation li-2009a-3 Nuclear Activity of ROXY1, a Glutaredoxin Interacting with TGA Factors, Is Required for Petal Development in Arabidopsis thaliana. nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Li S., Lauri A., Ziemann M., Busch A., Bhave M., Zachgo S. Binding strength was assessed by measuring growth of transfromed colonies on selective media containing SD/-Trp-His-Leu-Ade and 3-amino-1,2,4-triazole (3-AT) after incubation in a growth chamber at 28 degrees celcius for 2 to 5 days. The BiFC technique was employed to investigate ROXY1 interactions with TGA factors in planta. The N terminus of YFP (YN) was cloned inframe upstream of ROXY1. The C terminus of YFP (YC) was cloned inframe upstream of TGA2, TGA3, TGA7, and PAN individually. Constructs were pairwise transiently expressed in N. benthamiana leaves. Reconstitution of YFP fluorescence was examined by confocal microscopy 3 to 5 d after transient coexpression of protein pairs, and representative pictures are shown. Yellow fluorescence in the nucleus was detected for interactions of ROXY1 with PAN, TGA2, TGA3, and TGA7, respectively. Leaves from 3- to 4-week-old N. benthamiana plants were transformed by infiltrationof Agrobacterium tumefaciens cells harboring appropriate plasmids. zachgo@biologie.uni-osnbrueck.de Arabidopsis whole plant cDNA library Plant Cell (1040-4651) 2009 Only protein-protein interactions imex curation grxc7_arath Glutaredoxin-C7 GRXC7 AT.I.24-1 ROXY1 Protein ROXY 1 F1C9.22 F28J7.33 At3g02000 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQYQTESWGSYKMSSLGFGGLGMVADTGLLRIESLASESAVVIFSVSTCCMCHAVKGLFRGMGVSPAVHELDLHPYGGDIQRALIRLLGCSGSSSPGSLPVVFIGGKLVGAMDRVMASHINGSLVPLLKDAGALWL tga3_arath Transcription factor TGA3 TGA3 BZIP22 At1g22070 F2E2.14 bZIP transcription factor 22 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEMMSSSSSTTQVVSFRDMGMYEPFQQLSGWESPFKSDINNITSNQNNNQSSSTTLEVDARPEADDNNRVNYTSVYNNSLEAEPSSNNDQDEDRINDKMKRRLAQNREAARKSRLRKKAHVQQLEESRLKLSQLEQELVRARQQGLCVRNSSDTSYLGPAGNMNSGIAAFEMEYTHWLEEQNRRVSEIRTALQAHIGDIELKMLVDSCLNHYANLFRMKADAAKADVFFLMSGMWRTSTERFFQWIGGFRPSELLNVVMPYVEPLTDQQLLEVRNLQQSSQQAEEALSQGLDKLQQGLVESIAIQIKVVESVNHGAPMASAMENLQALESFVNQADHLRQQTLQQMSKILTTRQAARGLLALGEYFHRLRALSSLWAARPREHT pan_arath Transcription factor PERIANTHIA bZIP transcription factor 46 PAN F24J5.12 At1g68640 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQSSFKTVPFTPDFYSQSSYFFRGDSCLEEFHQPVNGFHHEEAIDLSPNVTIASANLHYTTFDTVMDCGGGGGGGLRERLEGGEEECLDTGQLVYQKGTRLVGGGVGEVNSSWCDSVSAMADNSQHTDTSTDIDTDDKTQLNGGHQGMLLATNCSDQSNVKSSDQRTLRRLAQNREAARKSRLRKKAYVQQLENSRIRLAQLEEELKRARQQGSLVERGVSADHTHLAAGNGVFSFELEYTRWKEEHQRMINDLRSGVNSQLGDNDLRVLVDAVMSHYDEIFRLKGIGTKVDVFHMLSGMWKTPAERFFMWLGGFRSSELLKILGNHVDPLTDQQLIGICNLQQSSQQAEDALSQGMEALQQSLLETLSSASMGPNSSANVADYMGHMAMAMGKLGTLENFLRQADLLRQQTLQQLHRILTTRQAARAFLVIHDYISRLRALSSLWLARPRD tga7_arath Transcription factor TGA7 TGA7 BZIP50 At1g77920 F28K19.13 bZIP transcription factor 50 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMSSSSPTQLASLRDMGIYEPFQQIVGWGNVFKSDINDHSPNTATSSIIQVDPRIDDHNNNIKINYDSSHNQIEAEQPSSNDNQDDDGRIHDKMKRRLAQNREAARKSRLRKKAYVQQLEESRLKLSQLEQELEKVKQQGHLGPSGSINTGIASFEMEYSHWLQEQSRRVSELRTALQSHISDIELKMLVESCLNHYANLFQMKSDAAKADVFYLISGMWRTSTERFFQWIGGFRPSELLNVVMPYLQPLTDQQILEVRNLQQSSQQAEDALSQGIDKLQQSLAESIVIDAVIESTHYPTHMAAAIENLQALEGFVNQADHLRQQTLQQMAKILTTRQSARGLLALGEYLHRLRALSSLWAARPQEPT tga4_arath Transcription factor TGA4 Ocs element-binding factor 4 TGA4 BZIP57 OBF4 At5g10030 T31P16_20 bZIP transcription factor 57 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNTTSTHFVPPRRFEVYEPLNQIGMWEESFKNNGDMYTPGSIIIPTNEKPDSLSEDTSHGTEGTPHKFDQEASTSRHPDKIQRRLAQNREAARKSRLRKKAYVQQLETSRLKLIHLEQELDRARQQGFYVGNGVDTNALSFSDNMSSGIVAFEMEYGHWVEEQNRQICELRTVLHGQVSDIELRSLVENAMKHYFQLFRMKSAAAKIDVFYVMSGMWKTSAERFFLWIGGFRPSELLKVLLPHFDPLTDQQLLDVCNLRQSCQQAEDALSQGMEKLQHTLAESVAAGKLGEGSYIPQMTCAMERLEALVSFVNQADHLRHETLQQMHRILTTRQAARGLLALGEYFQRLRALSSSWAARQREPT tga5_arath Transcription factor TGA5 TGA5 BZIP26 OBF5 At5g06960 MOJ9.13 Ocs element-binding factor 5 bZIP transcription factor 26 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGDTSPRTSVSTDGDTDHNNLMFDEGHLGIGASDSSDRSKSKMDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTAGDGAMAFDVEYRRWQEDKNRQMKELSSAIDSHATDSELRIIVDGVIAHYEELYRIKGNAAKSDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLIASQLEPLTEQQSLDINNLQQSSQQAEDALSQGMDNLQQSLADTLSSGTLGSSSSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTYQQMVRLLTTRQSARALLAVHNYTLRLRALSSLWLARPRE tga6_arath Transcription factor TGA6 TGA6 BZIP45 At3g12250 F28J15.6 MQC3.8 bZIP transcription factor 45 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADTSSRTDVSTDGDTDHRDLGSDRGHMHAAASDSSDRSKDKLDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTGGNGALAFDAEHSRWLEEKNRQMNELRSALNAHAGDTELRIIVDGVMAHYEELFRIKSNAAKNDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPMTERQVMGINSLQQTSQQAEDALSQGMESLQQSLADTLSSGTLGSSSSDNVASYMGQMAMAMGQLGTLEGFIRQADNLRLQTLQQMLRVLTTRQSARALLAIHDYSSRLRALSSLWLARPRE tga1_arath Transcription factor TGA1 DNA-binding protein TGA1a-like protein TGA1 BZIP47 At5g65210 MQN23.15 bZIP transcription factor 47 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNSTSTHFVPPRRVGIYEPVHQFGMWGESFKSNISNGTMNTPNHIIIPNNQKLDNNVSEDTSHGTAGTPHMFDQEASTSRHPDKIQRRLAQNREAARKSRLRKKAYVQQLETSRLKLIQLEQELDRARQQGFYVGNGIDTNSLGFSETMNPGIAAFEMEYGHWVEEQNRQICELRTVLHGHINDIELRSLVENAMKHYFELFRMKSSAAKADVFFVMSGMWRTSAERFFLWIGGFRPSDLLKVLLPHFDVLTDQQLLDVCNLKQSCQQAEDALTQGMEKLQHTLADCVAAGQLGEGSYIPQVNSAMDRLEALVSFVNQADHLRHETLQQMYRILTTRQAARGLLALGEYFQRLRALSSSWATRHREPT tga2_arath Transcription factor TGA2 TGA2 BZIP20 HBP1B At5g06950 MOJ9.12 HBP-1b homolog bZIP transcription factor 20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADTSPRTDVSTDDDTDHPDLGSEGALVNTAASDSSDRSKGKMDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISGTGDQAHSTGGNGALAFDAEHSRWLEEKNKQMNELRSALNAHAGDSELRIIVDGVMAHYEELFRIKSNAAKNDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPMTERQLMGINNLQQTSQQAEDALSQGMESLQQSLADTLSSGTLGSSSSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTLQQMIRVLTTRQSARALLAIHDYFSRLRALSSLWLARPRE grxc7-tga3-2 Glutaredoxin-C7interacts with TGA3 798413 n/a 798416 unspecified role unspecified role bait bait c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 798417 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Region 129-136 was the shortest region which was shown to bind to ROXY Q96305, but no growth characteristics were recorded in that case.A region of 99-136 amino acids was shown to have a binding strength of '+++' strong growth on selective media. Table 1 Region 129-136 was the shortest region which was shown to bind to ROXY Q96305, but no growth characteristics were recorded in that case.A region of 99-136 amino acids was shown to have a binding strength of '+++' strong growth on selective media. grxc7-pan-1 Glutaredoxin-C7interacts with PAN 798413 n/a 798418 unspecified role unspecified role prey prey n/a 798416 unspecified role unspecified role bait bait c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Region 129-136 was the shortest region which was shown to bind to ROXY Q96305, but no growth characteristics were recorded in that case.A region of 99-136 amino acids was shown to have a binding strength of '+++' strong growth on selective media. Table 1 Region 129-136 was the shortest region which was shown to bind to ROXY Q96305, but no growth characteristics were recorded in that case.A region of 99-136 amino acids was shown to have a binding strength of '+++' strong growth on selective media. grxc7-tga7-1 Glutaredoxin-C7interacts with TGA7 798413 n/a 798416 unspecified role unspecified role bait bait c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 798419 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Region 129-136 was the shortest region which was shown to bind to ROXY Q96305, but no growth characteristics were recorded in that case.A region of 99-136 amino acids was shown to have a binding strength of '+++' strong growth on selective media. Table 1 Region 129-136 was the shortest region which was shown to bind to ROXY Q96305, but no growth characteristics were recorded in that case.A region of 99-136 amino acids was shown to have a binding strength of '+++' strong growth on selective media. grxc7-tga4 Glutaredoxin-C7interacts with TGA4 798413 n/a 798420 unspecified role unspecified role prey prey n/a 798416 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Growth was reported to be '+' weak. Growth was reported to be '+' weak. grxc7-tga5 Glutaredoxin-C7interacts with TGA5 798413 n/a 798421 unspecified role unspecified role prey prey n/a 798416 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Growth was reported to be '+' weak. Growth was reported to be '+' weak. grxc7-tga6 Glutaredoxin-C7interacts with TGA6 798413 n/a 798416 unspecified role unspecified role bait bait n/a 798422 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Growth was reported to be '+' weak. Growth was reported to be '+' weak. grxc7-tga1 Glutaredoxin-C7interacts with TGA1 798413 n/a 798423 unspecified role unspecified role prey prey n/a 798416 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Growth was reported to be '+' weak. Growth was reported to be '+' weak. grxc7-tga2-1 Glutaredoxin-C7interacts with TGA2 798413 n/a 798424 unspecified role unspecified role prey prey n/a 798416 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Growth was reported to be '++' medium. Growth was reported to be '++' medium. grxc7-tga2 Glutaredoxin-C7interacts with TGA2 798414 n/a 798416 unspecified role unspecified role bait bait n/a 798424 unspecified role unspecified role prey prey physical association physical association false false false grxc7-tga3 Glutaredoxin-C7interacts with TGA3 798414 n/a 798416 unspecified role unspecified role bait bait n/a 798417 unspecified role unspecified role prey prey physical association physical association false false false grxc7-tga7 Glutaredoxin-C7interacts with TGA7 798414 n/a 798419 unspecified role unspecified role prey prey n/a 798416 unspecified role unspecified role bait bait physical association physical association false false false grxc7-pan Glutaredoxin-C7interacts with PAN 798414 n/a 798416 unspecified role unspecified role bait bait n/a 798418 unspecified role unspecified role prey prey physical association physical association false false false grxc7-tga7-3 Glutaredoxin-C7interacts with TGA7 798415 n/a 798419 unspecified role unspecified role neutral component neutral component n terminal C terminal region Yellow Flourescent Protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 798416 unspecified role unspecified role neutral component neutral component c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n-terminal N terminal region Yellow Flourescent Protein YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 2 grxc7-tga3-4 Glutaredoxin-C7interacts with TGA3 798415 n/a 798416 unspecified role unspecified role neutral component neutral component c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n-terminal N terminal region Yellow Flourescent protein YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 798417 unspecified role unspecified role neutral component neutral component n-terminal C terminal region Yelow Flourescent protein YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 2 grxc7-pan-3 Glutaredoxin-C7interacts with PAN 798415 n/a 798416 unspecified role unspecified role neutral component neutral component c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n-terminal N terminal region Yellow Flourescent protein YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 798418 unspecified role unspecified role neutral component neutral component n terminal C terminal region of Yellow Flourescent Protein YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 2 grxc7-tga2-3 Glutaredoxin-C7interacts with TGA2 798415 n/a 798424 unspecified role unspecified role neutral component neutral component n terminal C terminal region Yellow Flourescent Protein YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 798416 unspecified role unspecified role neutral component neutral component n terminal N terminal region Yellow Flourescent proetin (YFP) yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 2 The BiFC technique was employed to investigate ROXY1 interactions with TGA factors in planta. The N terminus of YFP (YN) was cloned inframe upstream of ROXY1. The C terminus of YFP (YC) was cloned inframe upstream of TGA2, TGA3, TGA7, and PAN individually. Constructs were pairwise transiently expressed in N benthamiana leaves. Reconstitution of YFP fluorescence was examined by confocal microscopy 3 to 5 d after transient coexpression of protein pairs, and representative pictures are shown. Yellow fluorescence in the nucleus was detected for interactions of ROXY1 with PAN, TGA2, TGA3, and TGA7, respectively.