IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ dean-2009-1 A novel ATM dependant X-ray inducible gene is essential for both plant meiosis and gametogenesis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Dean PJ., Siwiec T., Waterworth WM., Schlogelhofer P., Armstrong SJ., West CE. C.E.West@leeds.ac.uk Plant J. (0960-7412) 2009 Only protein-protein interactions imex curation dean-2009-2 A novel ATM dependant X-ray inducible gene is essential for both plant meiosis and gametogenesis. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Dean PJ., Siwiec T., Waterworth WM., Schlogelhofer P., Armstrong SJ., West CE. C.E.West@leeds.ac.uk Plant J. (0960-7412) 2009 Only protein-protein interactions imex curation mnd1_arath Meiotic nuclear division protein 1 homolog MND1 Meiotic nuclear division 1-like protein F19B15.200 At4g29170 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSKKRGLSLEEKREKMLQIFYESQDFFLLKELEKMGPKKGVISQSVKDVIQSLVDDDLVAKDKIGISIYFWSLPSCAGNQLRSVRQKLESDLQGSNKRLAELVDQCEALKKGREESEERTEALTQLKDIEKKHKDLKNEMVQFADNDPATLEAKRNAIEVAHQSANRWTDNIFTLRQWCSNNFPQAKEQLEHLYTEAGITEDFDYIELSSFPLSSSHEADTAKQLVQDEA mip1_arath MND1-interacting protein 1 At1g32530 MIP1 F5D14.31 T9G5.5 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGCTVREKHVKPTRRIKAAAFRSDPPLCWVEKIAMSQSIVENLVYHPGLTDSGSVNLNSVTENPEENFWAYCTEEHLEEILLKHLEFLYNQAVSKLLELGYEERVALKAVLSNGHCYGELDVLTNIVNNSLSYLNSGGGGGGSNGNGEDRTETGFTDLRDLEEYSLAGMIYLLQQVKPNLSKGDAMWCLLMSELHVGRASTLDVPTNRSSCCTKEDSNVEDVGTGGTLDIAGFMAPALCRFHGGWGFGNGGGPEFSGNGFSMKGAELKLQREIDCPKRFNLSPSMKSLLKRNVAAFAAGYRASMKQKQIQSSDTIGDSKACNDPAIVKSCGQQPRKSGSEESVSTVLEKFRDLNLDDNLESVGVDDKDCVIVDLLHQVKDFEKKVKERKEWAQKNAMQAAQKVSEELAELKTLSSEREGIQLLKKGKQAVEESTAKRFTDKEIELRKACSQNDRANVIVRKLENQNAEIRAEREGSKLSASESLKACMEASKKEKKCLKKLVAWEKQILKLQDEITAEKEKIKALYKTLAQITEYEKEIEAKWRQEQKAKEEALAQMEEEQRSKEAAEGHNKRKLETLRLKIELDFQRHKDDHQRLEQELGRLKASSDSDSSHISNNAWKPKKSQGENIAKLLEEIDKLEGSYDNEANYDRECIICMKDEVSVVFLPCAHQVVCGSCSDSFFASNNGGSKVTCPCCRGLVQQRIRIFGATS hop2_arath Homologous-pairing protein 2 homolog HOP2 T6J4.9 At1g13330 AHP2 Protein HOP2 Protein ARABIDOPSIS HOMOLOG PAIRING 2 Protein AHP2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAPKSDNTEAIVLNFVNEQNKPLNTQNAADALQKFNLKKTAVQKALDSLADAGKITFKEYGKQKIYIARQDQFEIPNSEELAQMKEDNAKLQEQLQEKKKTISDVESEIKSLQSNLTLEEIQEKDAKLRKEVKEMEEKLVKLREGITLVRPEDKKAVEDMYADKINQWRKRKRMFRDIWDTVTENSPKDVKELKEELGIEYDEDVGLSFQAYADLIQHGKKRPRGQ xri1_arath Protein XRI1 XRI1 Protein X-RAY INDUCED 1 K24G6.5 At5g48720 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDYGDDDRSSSWNWQVDNYNHQPQSHFSDVPDCTMTEVTLNQEDHSYMFDDENTPVKACSELGYHVTTEDTNRKMEVHSETRSALKRRRMLQFEDQPETSLFSSESFSAILKSSARDDTFDELLPEGSQLIEGFSEDASASSFEGLDLYAEEWYADCLNDAETPMLPDDLNFGSPDVQVDISEYLNVPPETETREVQRPVTRSSPNVIFKGRKSFSRPVSKLPSSIIYPFAFIKPCGVHGGMTLKDINQKIRNPPAKPKAHIEEPAVIQTSAFSGKPVVGKTKIRTEGGKGSITIMRTRG mip1-mnd1 MIP interacts with MND1 800505 n/a 800507 unspecified role unspecified role bait bait n/a 800508 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 8a mip1-2 MIP homodimer 800505 n/a 800508 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 800508 unspecified role unspecified role bait bait physical association physical association false false false Figure 8a mip1-ahp2 MIP interacts with AHP2 800505 n/a 800509 unspecified role unspecified role bait bait n/a 800508 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 8a mip1-xri1 MIP1 interacts with XRI1 800505 n/a 800510 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 800508 unspecified role unspecified role prey prey physical association physical association false false false Figure 8b Two UniProt proteins map to the TAIR locus At5g48720 ,Q6NLW5IS 226 amino acids in length and corresponds to the protein described by the authors and TAIR record whereas Q9FKC4 is 286 amino acids. In this case the shorter version of the UniProt protein mapping to the TAIR locus cited in the paper was annotated. mip1-mnd1-1 MIP interacts with MND1 800506 n/a 800508 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro n/a 800507 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 8c Figure 8d mip1-xri1-1 MIP1 interacts with XRI1 800506 n/a 800508 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminal sufficient to bind sufficient binding region sufficient to bind c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro n/a 800510 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 8c Figure 8d Two UniProt proteins map to the TAIR locus At5g48720 ,Q6NLW5IS 226 amino acids in length and corresponds to the protein described by the authors and TAIR record whereas Q9FKC4 is 286 amino acids. In this case the shorter version of the UniProt protein mapping to the TAIR locus cited in the paper was annotated.