IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zhang-2009-1 SEPA-1 mediates the specific recognition and degradation of P granule components by autophagy in C. elegans. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Zhang Y., Yan L., Zhou Z., Yang P., Tian E., Zhang K., Zhao Y., Li Z., Song B., Han J., Miao L., Zhang H. zhanghong@nibs.ac.cn Cell (0092-8674) 2009 Only protein-protein interactions 9 imex curation zhang-2009-2 SEPA-1 mediates the specific recognition and degradation of P granule components by autophagy in C. elegans. caeel-embryo Caenorhabditis elegans embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. confocal microscopy confocal microscopy immunostaining immunostaining Zhang Y., Yan L., Zhou Z., Yang P., Tian E., Zhang K., Zhao Y., Li Z., Song B., Han J., Miao L., Zhang H. zhanghong@nibs.ac.cn Cell (0092-8674) 2009 Only protein-protein interactions 9 imex curation zhang-2009-3 SEPA-1 mediates the specific recognition and degradation of P granule components by autophagy in C. elegans. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zhang Y., Yan L., Zhou Z., Yang P., Tian E., Zhang K., Zhao Y., Li Z., Song B., Han J., Miao L., Zhang H. zhanghong@nibs.ac.cn C. elegans cDNA Cell (0092-8674) 2009 Only protein-protein interactions 9 imex curation zhang-2009-4 SEPA-1 mediates the specific recognition and degradation of P granule components by autophagy in C. elegans. caeel-embryo Caenorhabditis elegans embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang Y., Yan L., Zhou Z., Yang P., Tian E., Zhang K., Zhao Y., Li Z., Song B., Han J., Miao L., Zhang H. zhanghong@nibs.ac.cn C. elegans cDNA Cell (0092-8674) 2009 Only protein-protein interactions 9 imex curation zhang-2009-5 SEPA-1 mediates the specific recognition and degradation of P granule components by autophagy in C. elegans. caeel-embryo Caenorhabditis elegans embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Zhang Y., Yan L., Zhou Z., Yang P., Tian E., Zhang K., Zhao Y., Li Z., Song B., Han J., Miao L., Zhang H. zhanghong@nibs.ac.cn Cell (0092-8674) 2009 Only protein-protein interactions 9 imex curation zhang-2009-6 SEPA-1 mediates the specific recognition and degradation of P granule components by autophagy in C. elegans. caeel-embryo Caenorhabditis elegans embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhang Y., Yan L., Zhou Z., Yang P., Tian E., Zhang K., Zhao Y., Li Z., Song B., Han J., Miao L., Zhang H. zhanghong@nibs.ac.cn Cell (0092-8674) 2009 Only protein-protein interactions 9 imex curation sepa1_caeel Protein sepa-1 sepa-1 Suppressor of ectopic P granules in autophagy M01E5.6 protein protein caeel Caenorhabditis elegans MTPLSALTSNPAPSPPPKFALGKCPATAIHVVSVLRPNRQRFCYEKTDAGDLIPHKCLICQPILTEKHISPYYAVYSDLLEDFVLFGYNTMTGKMEQFIYAFKTDCFVEVNRPEIKYNPAFLVKGNVVVALNGPEGELVVIERDCRGLLSKESTSYGQFRTLPTAALRTLTLQDLERDRWDRAANSDEVKISSGNESFDRLYAEYQKNLPRFQVRQCLHLNKEFLCVYSKTSGDYTRLEYIDETGDFQKISCTLCTCEVTESNLIPLYVERNASELVIHVHNTENNQIEQYIYDVRTFGFVQVKRNLVYDPKKITSGLNLFMAENIDNRKVYMIMRGRDGRLQKETSGSGGFEKMQPVAVKTFQVQWVEMKTEFEKKKASTERVEPQHPVQTEGEDIMETVLAMVESFNCDLRKELGLTQDQEIPRKAPRVESAETEENIVKNLEKLQIAKDPEEPTTAASEGGNTYGYQELDDTMSEGLLEKEAESKHQDANEPEPVKNVTYEPDVAAMDKKKKRRELKSRLNKINAQIDELEKRRMERAGKKQVVSSSVPSEEAAQVEAPASPALAENTNQISNEETPKIDIFEGYNGSFLFGTNTSKEWIVEDIRNHMVGKLLKAFWPRIQNVEEMNGELFKKLIANARKCETEILEASNDRDEYYRLMQLTVDQILKKTLKKDQRATEHNHQQPTQSSDELAKNHEKN lgg1_caeel Protein lgg-1 lgg-1 atg-8.1 C32D5.9 protein protein caeel Caenorhabditis elegans MKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSKLHDLDKKKYLVPSDLTVGQFYFLIRKRIQLRPEDALFFFVNNVIPQTMTTMGQLYQDHHEEDLFLYIAYSDESVYGGEVEKKE pgl3_caeel Guanyl-specific ribonuclease pgl-3 pgl-3 P granule abnormality protein 3 C18G1.4 protein protein caeel Caenorhabditis elegans MEANKRQIVEVDGIKSYFFPHLAHYLASNDELLVNNIAQANKLAAFVLGATDKRPSNEEIAEMILPNDSSAYVLAAGMDVCLILGDDFRPKFDSGAEKLSQLGQAHDLAPIIDDEKKISMLARKTKLKKSNDAKILQVLLKVLGAEEAEEKFVELSELSSALDLDFDVYVLAKLLGFASEELQEEIEIIRDNVTDAFEACKPLLKKLMIEGPKIDSVDPFTQLLLTPQEESIEKAVSHIVARFEEASAVEDDESLVLKSQLGYQLIFLVVRSLADGKRDASRTIQSLMPSSVRAEVFPGLQRSVFKSAVFLASHIIQVFLGSMKSFEDWAFVGLAEDLESTWRRRAIAELLKKFRISVLEQCFSQPIPLLPQSELNNETVIENVNNALQFALWITEFYGSESEKKSLNQLQFLSPKSKNLLVDSFKKFAQGLDSKDHVNRIIESLEKSSSSEPSATAKQTTTSNGPTTVSTAAQVVTVEKMPFSRQTIPCEGTDLANVLNSAKIIGESVTVAAHDVIPEKLNAEKNDNTPSTASPVQFSSDGWDSPTKSVALPPKISTLEEEQEEDTTITKVSPQPQERTGTAWGSGDATPVPLATPVNEYKVSGFGAAPVASGFGQFASSNGTSGRGSYGGGRGGDRGGRGAYGGDRGRGGSGDGSRGYRGGDRGGRGSYGEGSRGYQGGRAGFFGGSRGGS sepa1-1 Self assocation of SEPA-1 796785 n/a 796791 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 796791 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false G5EC37:p.Pro71Leu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 3C sepa1-lgg-3 Interaction between sepa-1 and lgg-1identified by pulldown 796785 n/a 796792 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 796791 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 6E sepa1-plg3-4 Interaction between sepa-1 and pgl-3 determined by pulldown 796785 n/a 796791 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 796793 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 5K sepa1-plg3-5 Interaction between sepa-1 and pgl-3 determined by pulldown 796785 n/a 796791 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 796793 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 796818 796816 physical association physical association false false false Fig. 5L sepa1-plg3-1 Colocalisation of sepa-1 and pgl-3 796786 n/a 796793 unspecified role unspecified role neutral component neutral component n/a 796791 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 5F, 5I sepa1-plg3-2 Interaction between sepa-1 and pgl-3determined by coimmunoprecipitation 796787 n/a 796793 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false n/a 796791 unspecified role unspecified role bait bait physical association physical association false false false Fig. 5J sepa1-plg3-3 Interaction between sepa-1 and pgl-3 796788 n/a 796791 unspecified role unspecified role prey prey n/a 796793 unspecified role unspecified role bait bait physical association physical association false false false Fig. 5M sepa1-lgg-1 Colocalisation between sepa-1 and lgg-1 796789 n/a 796791 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 796792 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 6C sepa1-lgg-2 Interaction between sepa-1 and lgg-1identified by co-immunoprecipitation 796790 n/a 796792 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 796791 unspecified role unspecified role prey prey physical association physical association false false false Fig. 6D, Supp. Fig. 10