IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kawahara-2009-4 SIRT6 links histone H3 lysine 9 deacetylation to NF-kappaB-dependent gene expression and organismal life span. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Kawahara TL., Michishita E., Adler AS., Damian M., Berber E., Lin M., McCord RA., Ongaigui KC., Boxer LD., Chang HY., Chua KF. Origin of constructs supplied by author Origin of constructs supplied by the author SIRT6 was also shown to bind to a ICAM gene promoter but this could not be assigned to a single gene howchang@stanford.edu, kfchua@stanford.edu Cell (0092-8674) 2009 Only protein-protein interactions 4 imex curation kawahara-2009-1 SIRT6 links histone H3 lysine 9 deacetylation to NF-kappaB-dependent gene expression and organismal life span. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kawahara TL., Michishita E., Adler AS., Damian M., Berber E., Lin M., McCord RA., Ongaigui KC., Boxer LD., Chang HY., Chua KF. Origin of constructs supplied by author howchang@stanford.edu, kfchua@stanford.edu Cell (0092-8674) 2009 Only protein-protein interactions 4 imex curation kawahara-2009-5 SIRT6 links histone H3 lysine 9 deacetylation to NF-kappaB-dependent gene expression and organismal life span. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Kawahara TL., Michishita E., Adler AS., Damian M., Berber E., Lin M., McCord RA., Ongaigui KC., Boxer LD., Chang HY., Chua KF. Origin of constructs supplied by author Origin of constructs supplied by the author howchang@stanford.edu, kfchua@stanford.edu Cell (0092-8674) 2009 Only protein-protein interactions 4 imex curation kawahara-2009-2 SIRT6 links histone H3 lysine 9 deacetylation to NF-kappaB-dependent gene expression and organismal life span. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kawahara TL., Michishita E., Adler AS., Damian M., Berber E., Lin M., McCord RA., Ongaigui KC., Boxer LD., Chang HY., Chua KF. Origin of constructs supplied by author howchang@stanford.edu, kfchua@stanford.edu Cell (0092-8674) 2009 Only protein-protein interactions 4 imex curation kawahara-2009-3 SIRT6 links histone H3 lysine 9 deacetylation to NF-kappaB-dependent gene expression and organismal life span. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Kawahara TL., Michishita E., Adler AS., Damian M., Berber E., Lin M., McCord RA., Ongaigui KC., Boxer LD., Chang HY., Chua KF. Origin of constructs supplied by author howchang@stanford.edu, kfchua@stanford.edu Cell (0092-8674) 2009 Only protein-protein interactions 4 imex curation birc3_human_gene Human BIRC3 gene gene gene human Homo sapiens Human sir6_human NAD-dependent protein deacetylase sirtuin-6 SIR2-like protein 6 SIRT6 SIR2L6 Regulatory protein SIR2 homolog 6 protein protein human Homo sapiens Human MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPKEESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVPS sodm_human_gene SODM_HUMAN_GENE/SOD2/Superoxide dismutase [Mn], mitochondrial gene gene human Homo sapiens Human tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS birc3_mouse_gene Murine BIRC3 gene gene gene mouse Mus musculus Mouse sir6_mouse NAD-dependent protein deacetylase sirtuin-6 Sirt6 Sir2l6 SIR2-like protein 6 Regulatory protein SIR2 homolog 6 protein protein mouse Mus musculus Mouse MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLMWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFENARPSKTHMALVQLERMGFLSFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECPKCKTQYVRDTVVGTMGLKATGRLCTVAKTRGLRACRGELRDTILDWEDSLPDRDLMLADEASRTADLSVTLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRQADLRIHGYVDEVMCRLMKHLGLEIPAWDGPCVLDKALPPLPRPVALKAEPPVHLNGAVHVSYKSKPNSPILHRPPKRVKTEAAPS il1rl1_mouse_gene Murine Il1rl1 gene gene gene mouse Mus musculus Mouse sirt6-birc3_gene-1 Binding of SIRT6 to the BIRC3 gene 794424 n/a 794429 unspecified role unspecified role prey prey n/a 794430 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2A TNF-alpha (20 ng/ml) Binding was to the promoter region of the gene sirt6-sodm Binding of SIRT6 to the SOD2 gene 794424 n/a 794431 unspecified role unspecified role prey prey n/a 794430 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2A TNF-alpha (20 ng/ml) Binding was to the promoter region of the gene sirt6-birc3_gene-2 Binding of SIRT6 to the BIRC3 gene 794424 n/a 794430 unspecified role unspecified role bait bait n/a 794429 unspecified role unspecified role prey prey association association false false false Figs. 2B, 2D, Supp. Fig. 2 TNF-alpha (20 ng/ml) Binding was to the promoter region of the gene RELA is required for recruitment of SIRT6 to the promoters of NF-kappaB target genes. sirt6-sodm-1 Binding of SIRT6 to the SOD2 gene 794424 n/a 794431 unspecified role unspecified role prey prey n/a 794430 unspecified role unspecified role bait bait association association false false false Figs. 2B, 2D, Supp. Fig. 2 TNF-alpha (20 ng/ml) Binding was to the promoter region of the gene RELA is required for recruitment of SIRT6 to the promoters of NF-kappaB target genes. sirt6-rela-1 Interaction between SIRT6 and RELA identified by coimmunoprecipitation 794425 n/a 794430 unspecified role unspecified role bait bait n/a 794432 unspecified role unspecified role prey prey physical association physical association false false false Figs. 1B, 1, Supp. Fig 1A TNF-alpha (20 ng/ml) sirt6-rela-3 Interaction between SIRT6 and RELA identified by coimmunoprecipitation 794425 n/a 794430 unspecified role unspecified role prey prey n/a 794432 unspecified role unspecified role bait bait physical association physical association false false false Supp. Fig 1B sirt6-birc3_gene-3 Binding of SIRT6 to the BIRC3 gene 794426 n/a 794433 unspecified role unspecified role prey prey n/a 794434 unspecified role unspecified role bait bait association association false false false Supp. Fig. 3 Interaction was not observed in Rela -/- cells sirt6-il1rl1-1 Binding of SIRT6 to the Il1rl1 gene 794426 n/a 794435 unspecified role unspecified role prey prey n/a 794434 unspecified role unspecified role bait bait association association false false false Supp. Fig. 3 Interaction was not observed in Rela -/- cells sirt6-rela-2 Interaction between SIRT6 and RELA identified by coimmunoprecipitation 794427 n/a 794430 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 794432 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1A sirt6-rela-4 Interaction between SIRT6 and RELA identified by pulldown 794428 n/a 794430 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 794432 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction false false false Figs. 1D, 1E