IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ryu-2009-1 Modulations of AtGSTF10 expression induce stress tolerance and BAK1-mediated cell death. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ryu HY., Kim SY., Park HM., You JY., Kim BH., Lee JS., Nam KH. Details of the cDNA library were obtained from a reference provided in the text. khnam514@sookmyung.ac.kr Arabidopsis cDNA 3 day old etiolated seedling. Biochem. Biophys. Res. Commun. (0006-291X) 2009 Only protein-protein interactions imex curation ryu-2009-2 Modulations of AtGSTF10 expression induce stress tolerance and BAK1-mediated cell death. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ryu HY., Kim SY., Park HM., You JY., Kim BH., Lee JS., Nam KH. Details of the cDNA library were obtained from a reference provided in the text. khnam514@sookmyung.ac.kr Arabidopsis cDNA 3 day old etiolated seedling. Biochem. Biophys. Res. Commun. (0006-291X) 2009 Only protein-protein interactions imex curation gstfa_arath Glutathione S-transferase F10 GSTF4 AtGSTF4 F7F1.8 At2g30870 GSTF10 ERD13 GST class-phi member 10 Protein EARLY RESPONSE TO DEHYDRATION 13 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVLTIYAPLFASSKRAVVTLVEKGVSFETVNVDLMKGEQRQPEYLAIQPFGKIPVLVDGDYKIFESRAIMRYIAEKYRSQGPDLLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVFAPLMGFPADEKVIKESEEKLAEVLDVYEAQLSKNEYLAGDFVSLADLAHLPFTEYLVGPIGKAHLIKDRKHVSAWWDKISSRAAWKEVSAKYSLPV bak1_arath BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 BAK1 SERK3 At4g33430 F17M5.190 Somatic embryogenesis receptor-like kinase 3 ELG Somatic embryogenesis receptor kinase 3 Protein ELONGATED protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERRLMIPCFFWLILVLDLVLRVSGNAEGDALSALKNSLADPNKVLQSWDATLVTPCTWFHVTCNSDNSVTRVDLGNANLSGQLVMQLGQLPNLQYLELYSNNITGTIPEQLGNLTELVSLDLYLNNLSGPIPSTLGRLKKLRFLRLNNNSLSGEIPRSLTAVLTLQVLDLSNNPLTGDIPVNGSFSLFTPISFANTKLTPLPASPPPPISPTPPSPAGSNRITGAIAGGVAAGAALLFAVPAIALAWWRRKKPQDHFFDVPAEEDPEVHLGQLKRFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGTLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPESQPPLDWPKRQRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEALVDVDLQGNYKDEEVEQLIQVALLCTQSSPMERPKMSEVVRMLEGDGLAERWEEWQKEEMFRQDFNYPTHHPAVSGWIIGDSTSQIENEYPSGPR bak1-gstf10 Interaction between BAK1 and GSTF10 798552 n/a 798554 unspecified role unspecified role prey prey n/a 798555 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind range range range range false physical association physical association false false false Figure 1 The authors state that the GST sequence showed a specific interaction with BAK1 kinase domain and displayed no interaction with several non-relevant baits". The co-ordinates are not provided in the text therefore the co-ordinates were taken from the UniProt record for this protein and annotated as fuzzy co-ordinates to indicate the exact co-ordinates are unknown. bak1-gstf10-1 Interaction between BAK1 and GSTF10 798553 n/a 798555 unspecified role unspecified role bait bait n/a 798554 unspecified role unspecified role prey prey n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 1e