MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint gl_er-2008-1 Towards understanding the nitrogen signal transduction for nif gene expression in Klebsiella pneumoniae. klepn Klebsiella pneumoniae pull down pull down predetermined predetermined participant predetermined Glöer J., Thummer R., Ullrich H., Schmitz RA. FEBS J. (1742-464X) 2008 Only protein-protein interactions imex curation nifa_klepn Nif-specific regulatory protein nifA protein protein klepn Klebsiella pneumoniae MIHKSDSDTTVRRFDLSQQFTAMQRISVVLSRATEASKTLQEVLSVLHNDAFMQHGMICLYDSQQEILSIEALQQTEDQTLPGSTQIRYRPGEGLVGTVLAQGQSLVLPRVADDQRFLDRLSLYDYDLPFIAVPLMGPHSRPIGVLAAHAMARQEERLPACTRFLETVANLIAQTIRLMILPTSAAQAPQQSPRIERPRACTPSRGFGLENMVGKSPAMRQIMDIIRQVSRWDTTVLVRGESGTGKELIANAIHHNSPRAAAAFVKFNCAALPDNLLESELFGHEKGAFTGAVRQRKGRFELADGGTLFLDEIGESSASFQAKLLRILQEGEMERVGGDETLRVNVRIIAATNRHLEEEVRLGHFREDLYYRLNVMPIALPPLRERQEDIAELAHFLVRKIAHSQGRTLRISDGAIRLLMEYSWPGNVRELENCLERSAVLSESGLIDRDVILFNHRDNPPKALASSGPAEDGWLDNSLDERQRLIAALEKAGWVQAKAARLLGMTPRQVAYRIQIMDITMPRL mint Required for activation of most nif operons, which are directly involved in nitrogen fixation q9za65_klepn glnK protein protein klepn Klebsiella pneumoniae MKLVTVVIKPFKLEDVRERLSSMGIQGLTVTEVKGFGRQKGHAELYRGAEYSVNFLPKVKIDVAIADDQLDEVVDVISKAAYTGKIGDGKIFVAELQRVIRIRTGESDEAAL mint nifl_klepn Nitrogen fixation regulatory protein nifL protein protein klepn Klebsiella pneumoniae MTLNMMLDNAVPEAIAGALTQQHPGLFFTMVEQASVAISLTDARANITYANPAFCRQTGYSLAQLLNQNPRLLASSQTPREIYQEMWQTLLQRQPWRGQLINQARDGGLYLVDIDITPVLNPQGELEHYLAMQRDISVSYTLEQRLRNHMTLMEAVLNNIPAAVVVVDEQDRVVMDNLAYKTFCADCGGKELLVELQVSPRKMGPGAEQILPVVVRGAVRWLSVTCWALPGVSEEASRYFVDSAPARTLMVIADCTQQRQQQEQGRLDRLKQQMTAGKLLAAIRESLDAALIQLNCPINMLAAARRLNGEGSGNVALDAAWREGEEAMARLQRCRPSLELESNAVWPLQPFFDDLYALYRTRFDDRARLQVDMASPHLVGFGQRTQLLACLSLWLDRTLALAAELPSVPLEIELYAEEDEGWLSLYLNDNVPLLQVRYAHSPDALNSPGKGMELRLIQTLVAYHRGAIELASRPQGGTSLVLRFPLFNTLTGGEQ Required for the inhibition of nifA activity in response to oxygen and low level of fixed nitrogen mint nifa-glnk 800389 nifa_klepn nifA 800390 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q9za65_klepn glnK 800391 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q9ZA65:p.Gly87Val mutation disrupting interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false F3A mint nifa-glnk-1 800389 nifa_klepn nifA 800390 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q9za65_klepn glnK 800391 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q9ZA65:p.Ala43Gly mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false F3A mint nifa-glnk-2 800389 q9za65_klepn glnK 800391 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q9ZA65:p.Ala49Thr mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false nifa_klepn nifA 800390 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F3A mint nifa-glnk-3 800389 nifa_klepn nifA 800390 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q9za65_klepn glnK 800391 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q9ZA65:p.Arg103Ser mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false F3A mint nifa-glnk-4 800389 q9za65_klepn glnK 800391 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q9ZA65:p.Asp108Gly mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false nifa_klepn nifA 800390 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F3A mint nifl-glnk 800389 q9za65_klepn glnK 800391 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q9ZA65:p.Gly87Val mutation disrupting interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false nifl_klepn nifL 800392 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F3B mint nifl-glnk-1 800389 nifl_klepn nifL 800392 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q9za65_klepn glnK 800391 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q9ZA65:p.Ala49Gly mutation disrupting interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false F3B mint nifl-glnk-2 800389 nifl_klepn nifL 800392 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q9za65_klepn glnK 800391 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q9ZA65:p.Ala43Gly mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false F3B mint nifl-glnk-3 800389 nifl_klepn nifL 800392 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q9za65_klepn glnK 800391 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q9ZA65:p.Arg103Ser mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false F3B mint